PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g044610.1.1
Common NameLOC101248552
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 376aa    MW: 40228.9 Da    PI: 7.2337
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g044610.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.75.5e-13118162347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ + ++lG+g+W+ I+r + + Rt+ q+ s+ qky
  Solyc12g044610.1.1 118 PWTEEEHRLFLIGLQKLGKGDWRGISRNFVTSRTPTQVASHAQKY 162
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.515319IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.105.4E-4322IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.705111167IPR017930Myb domain
SuperFamilySSF466891.87E-17113168IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-18114166IPR006447Myb domain, plants
SMARTSM007174.1E-9115165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-11116161IPR009057Homeodomain-like
PfamPF002493.1E-10118162IPR001005SANT/Myb domain
CDDcd001678.89E-9118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MTRRCSHCNN NGHNSRTCPT RGGVTGGVGG GSSGGGGVRL FGVRLTDGSI MKKSASMGNL  60
SSLHYHSSSS AAASPNPGSP SSDVLRESVH LTDGYLSDDP AHASSSANHR IERKKGIPWT  120
EEEHRLFLIG LQKLGKGDWR GISRNFVTSR TPTQVASHAQ KYFIRQSNAT RRKRRSSLFD  180
IVADTAADAS HPLPEEQFML PPRAMESDKE QLAPSATKAI ETDFADSLPS LDLSLKSNFE  240
SMETAPSEPV EETKPNTTIS EIPSGFPAFF PAYIPVPYPF WPSSAFPVPE DRGAEASHHQ  300
ILKPIPSVPK EPVNVDELVG MSQLTLADAG SGHIEPSPLS LKLTAEPSRQ SAFHASTPVK  360
SSEITKGETA PIQAI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.238430.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g044610.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252360.10.0transcription factor MYBS3
TrEMBLA0A3Q7JA320.0A0A3Q7JA32_SOLLC; Uncharacterized protein
STRINGSolyc12g044610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.19e-91MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]