PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g042070.1.1
Common NameSlARF2B
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 829aa    MW: 92468.3 Da    PI: 6.9138
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g042070.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.61e-22128229199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   
  Solyc12g042070.1.1 128 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL-- 215
                         99*****************************7333.34459************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Solyc12g042070.1.1 216 RGENGELRVGVRRA 229
                         449999*****996 PP

2Auxin_resp116.72e-38254336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha++tk+ F+v+Y+Pr+s+++F+v++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg++++d  rWp+SkWr+Lk
  Solyc12g042070.1.1 254 AWHAIQTKTLFTVYYKPRTSPADFIVPYDQYMESLKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIENADLKRWPESKWRCLK 336
                         89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.19E-40124257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-40124243IPR015300DNA-binding pseudobarrel domain
CDDcd100171.37E-20126228No hitNo description
SMARTSM010194.1E-22128230IPR003340B3 DNA binding domain
PROSITE profilePS5086311.42128230IPR003340B3 DNA binding domain
PfamPF023621.4E-20128229IPR003340B3 DNA binding domain
PfamPF065071.2E-35254336IPR010525Auxin response factor
PfamPF023097.5E-9700786IPR033389AUX/IAA domain
SuperFamilySSF542775.89E-11700774No hitNo description
PROSITE profilePS5174520.208703786IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 829 aa     Download sequence    Send to blast
MATSENCRNA AGAGKVDAEK ALYTELWRAC AGPLVTVPCE GELVFYFPQG HIEQVEASTN  60
QASDQQMPVY NLPSKILCRV INVLLKAEPD TDEVYAQVTL LPEPNQDENV VSKEPMPSPP  120
PRFHVHSFCK TLTASDTSTH GGFSVLRRHA DECLPPLDMS RQPPTQELVA KDLHANEWRF  180
RHIFRGQPRR HLLQSGWSVF VSSKRLVAGD AFIFLRGENG ELRVGVRRAM RQQGNAPSSV  240
ISSHSMHLGV LATAWHAIQT KTLFTVYYKP RTSPADFIVP YDQYMESLKN NYSIGMRFKM  300
RFEGEEAPEQ RFTGTIVGIE NADLKRWPES KWRCLKVRWD ETSAIPRPDR VSPWKVEPAL  360
SPPALNPLPI PRQKRPRSNV LPSSPDSSVL TREGSSKVVV DTSQASGFSR VLQGQEISTL  420
RGNFVENNES DSSEKPPIWQ PLLDDEKADV HSASRKCISD KRLPLGRPES SFTDLLSGFG  480
GQSSSSHGFH SPTGGQTAPA SWVKRQALDK ETDFSLLAKQ WSLVSSGLSL NLMESGLKGA  540
DTLYQMRGTS RLNCFNEYPT FPGHRPDNQQ GNWLMPPSVL PYIQMSAHSG EIMPKPMASP  600
QPEAMKPKEG NCKLFGIPLV SKCATIDPVM LRKNSPIHST SNMHFGIHPH QFPIIESDQR  660
SEQSKGSKLP DDGFIVHDQE EQFQTSHPGT RDREGKGLVH STRSCTKVHK QGTALGRSVD  720
LAKFNNYEEL IAELDHIFDF NGELKARNKN WLVVYTDDEG DMMLVGDDPW EFCGMVRKIF  780
IYTKDEVQRM NPGTLNSKGE DNSSVAEGSD AKEVKNLQLH IDSSPEDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17313581354Auxin response factor 1
4ldw_A1e-17313581354Auxin response factor 1
4ldw_B1e-17313581354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.7760.0fruit| leaf| root| trichome
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expression increases during floral development. Expressed during ovary development with the highest expression on the third day after the flower fully opened. {ECO:0000269|PubMed:21735233}.
UniprotTISSUE SPECIFICITY: Expressed in root, leaf and stem (PubMed:26716451, PubMed:21735233). Also expressed in flower and fruit (PubMed:26716451). Expressed in flower buds about three days before opening including stamen, petal and sepal with the highest in ovary (PubMed:21735233). {ECO:0000269|PubMed:21735233, ECO:0000269|PubMed:26716451}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs) (By similarity). Could act as transcriptional activator or repressor. Involved in the control of fruit ripening process. Regulates expression of a number of ripening regulators, transcription factors, and ethylene biosynthesis and signaling components (PubMed:26716451, PubMed:26959229). May act as a transcriptional repressor of auxin-responsive genes (PubMed:26716451). {ECO:0000255|RuleBase:RU004561, ECO:0000269|PubMed:26716451, ECO:0000269|PubMed:26959229}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g042070.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By tomato fruit ripening. Expression is up-regulated by plant hormone auxin in tomato fruits. {ECO:0000269|PubMed:26716451}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1439400.0Solanum lycopersicum auxin response factor 11-like (ARF11) mRNA, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252281.10.0auxin response factor 2B
SwissprotK4DF010.0ARF2B_SOLLC; Auxin response factor 2B
TrEMBLM1B5E80.0M1B5E8_SOLTU; Auxin response factor
STRINGSolyc12g042070.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  3. Hao Y, et al.
    Auxin Response Factor SlARF2 Is an Essential Component of the Regulatory Mechanism Controlling Fruit Ripening in Tomato.
    PLoS Genet., 2015. 11(12): p. e1005649
    [PMID:26716451]
  4. Breitel DA, et al.
    AUXIN RESPONSE FACTOR 2 Intersects Hormonal Signals in the Regulation of Tomato Fruit Ripening.
    PLoS Genet., 2016. 12(3): p. e1005903
    [PMID:26959229]