PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g019910.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 187aa    MW: 21078 Da    PI: 5.1791
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g019910.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.52e-1020501748
                        HHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding 17 kqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +++G ++W+ I++ ++  Rt+k+c++rw ++l
  Solyc12g019910.1.1 20 EEHGAKNWSFISQLIP-SRTAKSCRERWCNHL 50
                        79**************.*************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.016154IPR017930Myb domain
SuperFamilySSF466893.67E-171981IPR009057Homeodomain-like
CDDcd001676.74E-101950No hitNo description
Gene3DG3DSA:1.10.10.609.3E-171963IPR009057Homeodomain-like
PfamPF139214.4E-102064No hitNo description
PROSITE profilePS500904.8215187IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.8E-66485IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MKDNLNILTS NFVHTIYSLE EHGAKNWSFI SQLIPSRTAK SCRERWCNHL NPQLDHRSFT  60
LEEEDIIFKA HAKFGNQWTM IESLLYPWLS LDPHIAPFSE IFPFSSVSPV FPGLSTTMSI  120
SLIGFQSSQN LNPINPIEQE DEVTLVLASE PNPSNFMPQT SITQSGNSCL TNMEKQLLSP  180
IILKVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-1719851985MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-1716851685C-Myb DNA-Binding Domain
1msf_C1e-1716851685C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g019910.1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010314116.15e-50uncharacterized protein LOC101245137
TrEMBLK4DDL41e-133K4DDL4_SOLLC; Uncharacterized protein
STRINGSolyc12g019910.1.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3025422
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.18e-26myb domain protein 70
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]