PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g019900.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 191aa    MW: 21547.8 Da    PI: 7.4466
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g019900.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.8e-10942337
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtl 37
                        rW + Edell+++++++G ++W+ I++ ++  Rt 
  Solyc12g019900.1.1  9 RWNPGEDELLKKLIEEHGAKNWSFISQLIP-SRTM 42
                        9*****************************.9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.01E-8341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-10742IPR009057Homeodomain-like
PROSITE profilePS500907.201741IPR017877Myb-like domain
PfamPF002491.4E-8942IPR001005SANT/Myb domain
CDDcd001674.23E-10944No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MKIGQIKHRW NPGEDELLKK LIEEHGAKNW SFISQLIPSR TMSEDLTFEK PQLPLQRSSS  60
VGTCINLGSP SKSHLSNLEF SRFPQLCLYP PTIPLCQNLP HSTYSPVIPY PFTSLTFYES  120
YLSNLCISRY PWLSLYPYIA QLSEIFPFSS GSLVLPSPST TLILSLSGFK PIKNLNPINR  180
IDQEDEVTLV *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g019900.1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060234.14e-52transcription factor MYB41-like
TrEMBLA0A3Q7JUC91e-134A0A3Q7JUC9_SOLLC; Uncharacterized protein
STRINGSolyc12g019900.1.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3025322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.13e-08myb domain protein 73
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]