PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g019840.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 65aa    MW: 7798.74 Da    PI: 10.5974
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g019840.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.62.8e-18551148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        + rW + Ede+l+++v+++G ++W+ I++ ++  Rt+k+c++rw ++l
  Solyc12g019840.1.1  5 KRRWNPREDERLKRLVEKHGAKNWSFISQSFP-SRTEKSCRERWCNHL 51
                        579*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.611155IPR017930Myb domain
SMARTSM007172.7E-16453IPR001005SANT/Myb domain
PfamPF002494.9E-17551IPR001005SANT/Myb domain
SuperFamilySSF466895.52E-19558IPR009057Homeodomain-like
CDDcd001676.24E-14751No hitNo description
Gene3DG3DSA:1.10.10.602.8E-22764IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MGQIKRRWNP REDERLKRLV EKHGAKNWSF ISQSFPSRTE KSCRERWCNH LNPQSNHHPL  60
TTEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A3e-145641169MYB21
3osf_D3e-145641169MYB21
3osg_A3e-145641169MYB21
3osg_D3e-145641169MYB21
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}.
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g019840.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060233.11e-36transcription factor MYB44-like
SwissprotQ9FDW11e-19MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A3Q7J7905e-40A0A3Q7J790_SOLLC; Uncharacterized protein
STRINGSolyc12g019840.1.19e-41(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3025022
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.14e-22myb domain protein r1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y
    Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance.
    Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62
    [PMID:24275141]
  3. Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ
    Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence.
    BMC Plant Biol., 2013. 13: p. 192
    [PMID:24286353]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Li D, et al.
    Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44.
    Int J Mol Sci, 2014. 15(5): p. 8473-90
    [PMID:24828206]
  6. Xu DB, et al.
    A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis.
    PLoS ONE, 2015. 10(1): p. e0116385
    [PMID:25635681]
  7. Hieno A, et al.
    Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis.
    Microbes Environ., 2016. 31(2): p. 154-9
    [PMID:27301421]
  8. Zhao Q, et al.
    AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana.
    Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785
    [PMID:27604593]
  9. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  10. Nguyen NH,Cheong JJ
    H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress.
    Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043
    [PMID:29649476]
  11. Nguyen NH,Cheong JJ
    AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription.
    Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442
    [PMID:30448055]