PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g019810.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 75aa    MW: 8854.04 Da    PI: 5.6157
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g019810.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-16753148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        + rW + Edell+++++++G ++W+ I + ++  Rt+k+c+++w ++l
  Solyc12g019810.1.1  7 KRRWNPGEDELLKKLIEEHGAKNWSFICQLIP-SRTEKSCREFWCDHL 53
                        579*****************************.***********9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.909257IPR017930Myb domain
SuperFamilySSF466891.36E-17368IPR009057Homeodomain-like
SMARTSM007176.1E-14655IPR001005SANT/Myb domain
PfamPF002492.8E-15753IPR001005SANT/Myb domain
CDDcd001671.44E-12953No hitNo description
Gene3DG3DSA:1.10.10.604.5E-23971IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MKMGQIKRRW NPGEDELLKK LIEEHGAKNW SFICQLIPSR TEKSCREFWC DHLNPQLDHQ  60
PFNPEEEDII FQGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g019810.1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060233.14e-33transcription factor MYB44-like
TrEMBLA0A3Q7J7864e-48A0A3Q7J786_SOLLC; Uncharacterized protein
STRINGSolyc12g019810.1.16e-49(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1853624
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-21myb domain protein 73
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]