PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g011220.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 234aa    MW: 26585.1 Da    PI: 6.5083
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g011220.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like45.31.9e-14110163255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+ Wt eLH++F+++++  GG+ +  P++i + m   g++  ++k  LQ+YR 
  Solyc12g011220.1.1 110 PRVLWTDELHRKFLDVINAYGGPWVVKPRHIWKEMAHLGVSHCQIKNRLQRYRA 163
                         89***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.99E-11107166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-12108165IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-11110164IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MIPLPPSPAV NIGNFQSPNI PTMQHCYDEL MSLQQSQFNY QPTNDFSFLE NHGLMRLFGG  60
QNTINNNVVG YQDPFMLNPN VINFNIAHQV QQELGQQLNN VGSASRIKPP RVLWTDELHR  120
KFLDVINAYG GPWVVKPRHI WKEMAHLGVS HCQIKNRLQR YRAKLNPNEA GGRKCKASSN  180
KELIQDVQEQ LNNVDGGKAD DNVYVPQLPT EAERMEAHIS PDDAFIEELL NWM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g011220.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092751e-135Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0131P16, complete sequence
GenBankEU1247361e-135Solanum lycopersicum clone C12HBa0143N09, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025884461.11e-63transcription factor HHO6-like
TrEMBLK4DCL01e-143K4DCL0_SOLLC; Uncharacterized protein
STRINGSolyc12g011220.1.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14605411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-10G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]