PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g011190.1.1
Common NameLOC101264794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 294aa    MW: 32281.1 Da    PI: 9.8507
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g011190.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK65.39.4e-213280351
              RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51
                        k++s++d+sk Fslp+ dAA +Lgvc++vLK+iC ++G+ RWP+Rk++s
  Solyc12g011190.1.1 32 KSVSFDDVSKLFSLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVSS 80
                        789*******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.44812101IPR003035RWP-RK domain
PfamPF020422.7E-193480IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MSNLQGSAPS SNPNPIQNPN PNPYPKPIMD PKSVSFDDVS KLFSLPLSDA AESLGVCASV  60
LKKICYENGL VRWPYRKVSS GKSIEDIKKE ALREKQERSL EFPKAPGEKN GSLASSAISS  120
FSGSPLPNKS ISSTMEMPRA GVFSQQQGTR NFQSGSSPHF RISNLTKGTS VYDEFKYGFP  180
SDGLSTATYR WWGNKSPDGN QDSKLNDDNA KNSTEQAENV AEKTECQTSV DSTGTTLLTD  240
VRKRAAKEGK ETLRLGVHRR RSAKMLDSTK RKILHQVFKS YFHVHGDMSS MES*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.215100.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g011190.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251823.10.0protein NLP7
TrEMBLA0A3Q7J4Y80.0A0A3Q7J4Y8_SOLLC; Uncharacterized protein
STRINGSolyc12g011190.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107441921
Representative plantOGRP866899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.23e-10Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]