PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g010800.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 307aa    MW: 34993.9 Da    PI: 5.4415
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g010800.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.96.6e-11179222548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         kr +r   NR +A+rsR RK++++ eLe+ v +L+ae + L  +
  Solyc12g010800.1.1 179 KRIKRILANRQSAQRSRVRKLQYVSELERSVTTLQAEVSVLSPR 222
                         899*********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14175239IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.565177229IPR004827Basic-leucine zipper domain
PfamPF001702.6E-9179223IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-11179233No hitNo description
Gene3DG3DSA:1.20.5.1705.0E-13179230No hitNo description
CDDcd147039.20E-22180230No hitNo description
PROSITE patternPS000360182197IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAHLPPRAPN MTQNWPDFSL HQKMENLAPS AHNLWADEFL DMSSRRGSHR RSMSDSIAFL  60
ESPMVEECRR LSSTTPGSGG TTNGHDEFER FDDEQQIMSM FNDDVHDMSC SNPSSPSDYI  120
NVTEDKKMNG PDQMMMQRKS DQNEEVESSC KTNEELATAN QNASTNNNEY SSERVVDPKR  180
IKRILANRQS AQRSRVRKLQ YVSELERSVT TLQAEVSVLS PRVAFLDHQR LLLNVDNSAL  240
RQKIAALAQD KLFKDAHQEA LKVEIERLRQ IYYQQNMKQQ MDNNNTTPVA DSTNTPPEIK  300
VQLSEN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.70260.0leaf| root| seed
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator. {ECO:0000269|PubMed:17719007}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g010800.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251798.10.0basic leucine zipper 34-like
SwissprotQ9M2K42e-93BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A3Q7J4S20.0A0A3Q7J4S2_SOLLC; Uncharacterized protein
STRINGSolyc12g010800.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-74bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gibalov√° A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]