PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g010330.1.1
Common NameLOC101246797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 709aa    MW: 77633.4 Da    PI: 6.1814
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g010330.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.27.5e-28208261155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Solyc12g010330.1.1 208 KPRVVWAIELHKKFVTAVHQL-GLEKAVPKRILDLMNVEGLTRENVASHLQKYRL 261
                         79*******************.********************************7 PP

2Response_reg80.65.1e-27261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll  +l+k +y +v++++++++al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++++++ + 
  Solyc12g010330.1.1  26 VLAVDDDPICLKLLDGLLRKCQY-HVTTTSQARSALKMLRENKdrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDSKLVMKG 114
                         799********************.***************888889*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l+Kp+  eel +
  Solyc12g010330.1.1 115 ITHGACDYLVKPVRLEELKN 134
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.1E-1571702IPR017053Response regulator B-type, plant
SuperFamilySSF521721.11E-3523150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.4E-4323159No hitNo description
SMARTSM004487.1E-3224136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.56925140IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2426134IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.15E-2827140No hitNo description
PROSITE profilePS5129410.93205264IPR017930Myb domain
SuperFamilySSF466895.91E-18205265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28205266IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-24208262IPR006447Myb domain, plants
PfamPF002493.8E-6211260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MTVEEIRGNM GGERENYDNF PVGMRVLAVD DDPICLKLLD GLLRKCQYHV TTTSQARSAL  60
KMLRENKDRF DLVISDVHMP DMDGFKLLEL VGLEMDLPVI MLSANSDSKL VMKGITHGAC  120
DYLVKPVRLE ELKNIWQHVI RRKKVEPKKQ NKSDDQDKAH QGGGEGERGS QVSGNADQNG  180
KVNKKRKDEE YESDENGNDD EDPGTQKKPR VVWAIELHKK FVTAVHQLGL EKAVPKRILD  240
LMNVEGLTRE NVASHLQKYR LFLKRINAAD AQQANLAAAA LGGKDSAYMR MGSLDGLGGF  300
RTLAGSGRFG QASLSSSYAS GGMLGRLNSP SGVSLRNLAS TPILQPNHGQ NMSNNSLNAL  360
MKFNANVPPA SQNANFFQGI PASLELDQLQ QSKCATHIGE LNPLDESGLH TVASTFTNSR  420
LVGSANSSMP NVSNNPILLQ VNSQQPLTGM GFGNQTSLNV ASFSSEAFNT GVSGSSNFLD  480
HDRYSNENWQ TSLQPLKFQS TSFPLNEPFS NSHLPQDRVR DNDTSTGPHL QNNPVDFSTS  540
TIVSVPFEAS RGETQCRESL GAAVQIMNQA TCQRWPDQNQ HYSHNSNNIF GNMSSQVSSN  600
GGMASLTHPV DQNNDMFCTR VETSLNCISN GSSSMHTHNR ESEKLTHDSR TKTNEDYLFQ  660
TTKQQVGFLP QGYGSLDDLM GEMKQDQDGA MLDGGEFGFD AYSLGSGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-23206267364ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.112500.0callus
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g010330.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251765.10.0two-component response regulator ORR24-like
SwissprotQ6H8051e-136ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A3Q7J4I80.0A0A3Q7J4I8_SOLLC; Uncharacterized protein
STRINGSolyc12g010330.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22582458
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]