PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g008800.1.1
Common NameLOC101267581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 189aa    MW: 20637 Da    PI: 10.0395
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g008800.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.5e-16118162347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++++ ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Solyc12g008800.1.1 118 PWTEEEHRRFLNGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 162
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.398111167IPR017930Myb domain
SuperFamilySSF466891.29E-18113168IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-20114166IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-12115162IPR009057Homeodomain-like
SMARTSM007171.2E-11115165IPR001005SANT/Myb domain
CDDcd001671.46E-10118163No hitNo description
PfamPF002496.8E-13118162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MGRKCSHCGY IGHNSRTCST LKSAISGSNF NGGLRLFGVQ LDISNSCFSS HNNNNNNNLK  60
KSFSLDCLSL TNSHLLLLSS SSSPSLNENS STNSIDNNGY LSDGTLVGCV GERKKGVPWT  120
EEEHRRFLNG LEKLGKGDWR GISRNFVTTR TPTQVASHAQ KYFLRQSSLN KKKDVQVSSI  180
WQGATTNM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.201600.0flower| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in all tissues, with the highest level in senescent leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g008800.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251664.11e-135transcription factor MYBS3
SwissprotQ7XC574e-48MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A3Q7JRY21e-134A0A3Q7JRY2_SOLLC; Uncharacterized protein
STRINGSolyc12g008800.1.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-42MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  4. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]