PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g006280.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 175aa    MW: 20316.2 Da    PI: 9.9449
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g006280.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like932.4e-292982255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH+ F++ v++LGG +kAtPk+i+++m +kgL ++hvkSHLQ+YR 
  Solyc12g006280.1.1 29 PRLRWTPQLHHLFIQSVQNLGGRNKATPKRIVQMMAIKGLKISHVKSHLQMYRN 82
                        9****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-252884IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-222982IPR006447Myb domain, plants
SuperFamilySSF466892.15E-132984IPR009057Homeodomain-like
PfamPF002495.5E-73081IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEIFLMSQEM MRKSKKMKEV RKYKKSLAPR LRWTPQLHHL FIQSVQNLGG RNKATPKRIV  60
QMMAIKGLKI SHVKSHLQMY RNMREHPSLH VVMQDFNLSS PMHVSKILGE HAQNSRKQKE  120
SGSQNGENIH YNDFQEVEGS LSSGMTKEEE EDNDGEIYEY RETSTQINLD LTLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-173084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-173084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-173084357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-173084357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-173084458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g006280.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251553.11e-127putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A3Q7JRD01e-126A0A3Q7JRD0_SOLLC; Uncharacterized protein
STRINGSolyc12g006280.1.11e-126(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.19e-25G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]