PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g005890.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 406aa    MW: 45178.4 Da    PI: 5.8869
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g005890.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-162267146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        +g+WTt Ed +l ++vk++G g+W+++ r  g+ R++k+c++rw+ 
  Solyc12g005890.1.1 22 KGPWTTTEDAILMEYVKKHGEGNWNAVQRNSGLMRCGKSCRLRWRR 67
                        79******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2511773IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-171967IPR009057Homeodomain-like
SuperFamilySSF466898.22E-142179IPR009057Homeodomain-like
SMARTSM007179.9E-102171IPR001005SANT/Myb domain
PfamPF002493.0E-142267IPR001005SANT/Myb domain
CDDcd001672.95E-102467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MAPSGGGVNK NNGGGTRQVL KKGPWTTTED AILMEYVKKH GEGNWNAVQR NSGLMRCGKS  60
CRLRWRRQRA GLPIYPQDIQ PQNYQQDQNQ QHSTNIPSPF DNHQNSNYNN NSPLSLLDIF  120
NPSTMKPSRN IIPHQYQFNN NPSSPFLTNT NNINNQVKFF HDPRVSLSLT LASSMKNSQL  180
SSIVAPVPNN FSQRYSSSMP VPPLQHTYPN FTTTTRPYTT ISSNPNGLIL GMGIEHRSIP  240
SSVPRTTSTS SDHVDNNYTI NHGLSRGNSG LLEDLLEESH TLTRGEKIEE NCPIENEDNN  300
KGKLVWEEYG LTEEAADAIF TEESTYNFSH NHSEDSSSPH SSSGITTKEA SLENIGNQVD  360
DDIMRFLDNF PLGVPVPDWC DDQQNTSNGQ SFECDQIQLS SKSSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc12g005890.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2127660.0Solanum lycopersicum DNA sequence from clone LE_HBa-90D9 on chromosome 12, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015060875.10.0transcription factor MYB101-like
TrEMBLA0A3Q7J2K40.0A0A3Q7J2K4_SOLLC; Uncharacterized protein
STRINGSolyc12g005890.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-24myb domain protein 101
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]