PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc12g005420.1.1
Common NameLOC101253977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family DBB
Protein Properties Length: 283aa    MW: 30632.5 Da    PI: 6.2274
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc12g005420.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box162.5e-05446541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+ +e  e++  C  ++  lC  C ++ H        H++v 
  Solyc12g005420.1.1  4 QCNACEVAEAKVLCCADEAALCWYCDDKVHAAnklankHQRVA 46
                        7******99*********************6678888888775 PP

2zf-B_box26.81.1e-085386235
            zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                         ++kC+ ++e    +fC +++ llC++C  ++H 
  Solyc12g005420.1.1 53 PMPKCDICQETVGFFFCLEDRALLCRKCDISIHT 86
                        689*******9999*******************3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.755147IPR000315B-box-type zinc finger
CDDcd000211.64E-4347No hitNo description
SMARTSM003361.5E-6447IPR000315B-box-type zinc finger
PROSITE profilePS501198.9875299IPR000315B-box-type zinc finger
SMARTSM003367.3E-155299IPR000315B-box-type zinc finger
PfamPF006431.1E-65395IPR000315B-box-type zinc finger
CDDcd000211.50E-85599No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MKIQCNACEV AEAKVLCCAD EAALCWYCDD KVHAANKLAN KHQRVALSAS SSPMPKCDIC  60
QETVGFFFCL EDRALLCRKC DISIHTVNAY VSSHQRFLLT GVKVGLEPLG PCASASSRKS  120
HEQRSPPILK ITPPSEGVLP VHTSGNGNFA PSRLPIVGNI PQCQFDQYLG MPDFNQNYGY  180
MDYGQSKAGN GKVGESASSP FLRDVDAEVA GDECFSTEVP DTCWAVPQIP SSPTASGLNW  240
PTKSIQNPFD AALLESDASY FPLQNIQDQQ SNGSGTKRSR RF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2095330.0Solanum lycopersicum DNA sequence from clone LE_HBa-140M1 on chromosome 12, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252027.10.0PREDICTED: B-box zinc finger protein 22-like
SwissprotQ9SYM21e-79BBX22_ARATH; B-box zinc finger protein 22
TrEMBLK4DB800.0K4DB80_SOLLC; Uncharacterized protein
STRINGSolyc12g005420.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18041634
AsteridsOGEA28922346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.17e-81light-regulated zinc finger protein 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]