PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g072790.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 210aa    MW: 24032.5 Da    PI: 8.6982
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g072790.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19364157
                        TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r +R+++t+eql  Lee+++k  r+p+a++++ ++ +l    +++ ++V++WFqN++a++++
  Solyc11g072790.1.1  3 RPTRWSPTPEQLMFLEEMYRKgLRNPNATQIQSITCHLssfgKIEGKNVFYWFQNHKARDRQ 64
                        569*****************99*************************************996 PP

2Wus_type_Homeobox111.54.5e-36565464
   Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        tRW+PtpeQ++ Lee+y++Glr+Pn+ +iq it +L+++Gkie+kNVfyWFQN+kaR+rqk
  Solyc11g072790.1.1  5 TRWSPTPEQLMFLEEMYRKGLRNPNATQIQSITCHLSSFGKIEGKNVFYWFQNHKARDRQK 65
                        8***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.333165IPR001356Homeobox domain
SMARTSM003894.5E-5269IPR001356Homeobox domain
PfamPF000463.4E-17364IPR001356Homeobox domain
SuperFamilySSF466892.48E-11369IPR009057Homeodomain-like
CDDcd000861.90E-4365No hitNo description
Gene3DG3DSA:1.10.10.601.3E-6664IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRPTRWSPT PEQLMFLEEM YRKGLRNPNA TQIQSITCHL SSFGKIEGKN VFYWFQNHKA  60
RDRQKLKKKL LAQMNQQQIL AQYPIDAHST TTTTTNSNNN TLFHCPTTDQ YQICPLTSTT  120
ALLQEGEIKE ASSQVMTYLY PMDLSKPADQ NMENCMIRPY GKDWIVMMNI NPNNLPYCVN  180
RPLKTLPLFP ITTTDDLKDQ TTSSTSLSL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g072790.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154818e-14Solanum lycopersicum chromosome 2 clone C02SLm0057H03, complete sequence
GenBankAJ5383298e-14Lycopersicon esculentum mRNA for wuschel protein (wus gene)
GenBankJF2848468e-14Solanum lycopersicum clone Le_HBa0139K19 genomic sequence, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251286.11e-156WUSCHEL-related homeobox 3
TrEMBLA0A3Q7J2111e-155A0A3Q7J211_SOLLC; Uncharacterized protein
STRINGSolyc11g072790.1.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Representative plantOGRP55801121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.12e-38WOX family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]