PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g072770.1.1
Common NameLOC101266096
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family WOX
Protein Properties Length: 198aa    MW: 22760.1 Da    PI: 9.8426
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g072770.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.1e-19363257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        r+R+++t++ql +L++l++k  r+p+ ++ ++++++l    +++ ++V++WFqN++a++++
  Solyc11g072770.1.1  3 RPRWSPTPQQLMILQDLYRKgLRNPTSSQVQKITTHLslygKIQCKNVFYWFQNHKARDRQ 63
                        89*****************99*************************************996 PP

2Wus_type_Homeobox107.77.2e-35264264
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        +r+RW+Ptp+Q++iL++ly++Glr+P+++++q+it++L+ yGki+ kNVfyWFQN+kaR+rqk
  Solyc11g072770.1.1  2 PRPRWSPTPQQLMILQDLYRKGLRNPTSSQVQKITTHLSLYGKIQCKNVFYWFQNHKARDRQK 64
                        579***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.2E-7168IPR001356Homeobox domain
PROSITE profilePS5007110.787164IPR001356Homeobox domain
CDDcd000863.63E-6264No hitNo description
PfamPF000461.6E-16363IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-8363IPR009057Homeodomain-like
SuperFamilySSF466893.89E-11364IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MPRPRWSPTP QQLMILQDLY RKGLRNPTSS QVQKITTHLS LYGKIQCKNV FYWFQNHKAR  60
DRQKLRKELM MLHKIHKNTS DDDVPHQFHT TQNTNSNLEY NFPPSTFHTL YPQSPSILVH  120
QGEGKDTSSS STQMMNNMGN VDFPKHCVIE NGMMRTNVQG WILMMTDMGP ISIPSCSSNK  180
PLETLELFPI KATGIKE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g072770.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251451.11e-147WUSCHEL-related homeobox 3-like
TrEMBLA0A3Q7J0Z71e-146A0A3Q7J0Z7_SOLLC; Uncharacterized protein
STRINGSolyc11g072770.1.11e-147(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Representative plantOGRP55801121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.13e-31WOX family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]