PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g072500.1.1
Common NameLOC101250661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 286aa    MW: 32419.9 Da    PI: 7.4733
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g072500.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-393898262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++ +kcprCds+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn+k s
  Solyc11g072500.1.1 38 EQQPQKCPRCDSANTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNRKLS 98
                        57899****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-303796IPR003851Zinc finger, Dof-type
PfamPF027016.0E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0314296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MCIMDHHQQE MTSQTLESML VCAKPDQDQK KPRPAAAEQQ PQKCPRCDSA NTKFCYYNNY  60
SLTQPRYFCK SCRRYWTKGG TLRNVPVGGG CRKNRKLSSA KRSSQDNISP NSSNSSTDLS  120
LAFARLQKQT NAIDQEQDTN NNMSMMYNTN NDNTSTTFLD ALRGGFLENH HGLFQHNMYN  180
YANMGQLVEN GEMGLSYDQD QMSIGTMMTT TMKQEMCNVA RSTEGHDLND NNKVLWGFPW  240
QQMSGDHHVN NNMNTNDFEY STNKQSWNGF GGSSNWHGLI NSPLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.91320.0flower| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO43823440.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g072500.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251272.10.0dof zinc finger protein DOF5.3
TrEMBLA0A3Q7J0U30.0A0A3Q7J0U3_SOLLC; Uncharacterized protein
STRINGSolyc11g072500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-45TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]