PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g072330.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 331aa    MW: 36482.8 Da    PI: 9.2863
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g072330.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.84.2e-22150203155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kp++ Wt  LH++F+ea++ + G  kA+Pk+i e+m+v+gLt+e+v SH QkYR 
  Solyc11g072330.1.1 150 KPQIIWTDSLHHAFLEAIHDI-GFSKAVPKKIHEHMNVPGLTRENVSSHWQKYRN 203
                         68999****************.9*******************************6 PP

2Response_reg37.71.1e-1311100190
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+vdD+ + +++++++l+k +y ++ +++ + +al +l  k   +Dli++D+  ++m+G +l + i+e+  ++p++ ++a ++e  +l+ 
  Solyc11g072330.1.1  11 ILVVDDNAAYLQVVAELLKKCNY-QAVAVKYPIDALPKLqiKVDSCDLIVIDVHKSDMNGCKLQEMIAEAF-EIPVLSMSADQKEGAILKG 99 
                         89*********************.666677777888777346666**********************9999.9********9999888887 PP

                         H CS
        Response_reg  90 l 90 
                         l
  Solyc11g072330.1.1 100 L 100
                         7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.5E-166101No hitNo description
SuperFamilySSF521726.69E-157101IPR011006CheY-like superfamily
PROSITE profilePS5011019.15910126IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-911101IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.77E-812101No hitNo description
SuperFamilySSF466891.65E-16148207IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-22149207IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-20150203IPR006447Myb domain, plants
PfamPF002499.5E-7155202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MSSKTAQKIS ILVVDDNAAY LQVVAELLKK CNYQAVAVKY PIDALPKLQI KVDSCDLIVI  60
DVHKSDMNGC KLQEMIAEAF EIPVLSMSAD QKEGAILKGL KGLSVDDQRD KGLCTVLQEK  120
KGKRAVPGKS AMKQRKRGKD NSGDLVLPTK PQIIWTDSLH HAFLEAIHDI GFSKAVPKKI  180
HEHMNVPGLT RENVSSHWQK YRNYLHRVID SSSINKVPDK NLASRANQST IASGMLVKHR  240
QVHQENFGVQ SSVPSSLIHP STGYLTGNLQ HLKNKGKEVD VVLDPVRNFS VFHKVSAMQG  300
LQGIGDLSAS SMNQGNDQPH QDMETEDNLQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-14150208563ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.228680.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g072330.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251256.10.0two-component response regulator ORR21 isoform X1
RefseqXP_004251257.10.0two-component response regulator ORR21 isoform X1
RefseqXP_010313509.10.0two-component response regulator ORR21 isoform X1
RefseqXP_010313510.10.0two-component response regulator ORR21 isoform X1
RefseqXP_010313513.10.0two-component response regulator ORR21 isoform X1
RefseqXP_010313514.10.0two-component response regulator ORR21 isoform X1
RefseqXP_019066717.10.0two-component response regulator ORR21 isoform X1
RefseqXP_019066718.10.0two-component response regulator ORR21 isoform X1
RefseqXP_019066719.10.0two-component response regulator ORR21 isoform X1
RefseqXP_025883995.10.0two-component response regulator ORR21 isoform X1
RefseqXP_025883996.10.0two-component response regulator ORR21 isoform X1
RefseqXP_025883997.10.0two-component response regulator ORR21 isoform X1
TrEMBLA0A3Q7J1090.0A0A3Q7J109_SOLLC; Uncharacterized protein
STRINGSolyc11g072330.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32902038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-32response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]