PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g072150.1.1
Common NameLOC101267198
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YC
Protein Properties Length: 306aa    MW: 33422.9 Da    PI: 4.6829
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g072150.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.85.7e-196861898
               NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                        ++++P arikki++adedv +i+  +P l+ska elf+ +l  r++  + ++  +t++   ++ ++++ ++fdfl d+v r
  Solyc11g072150.1.1  6 DTRFPAARIKKIMQADEDVGKIAMAVPLLVSKALELFLQDLCDRTYEITLKKGAKTMNSFHLKHCIQSFNVFDFLKDVVSR 86
                        5789**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.2E-20388IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.7E-25372IPR009072Histone-fold
PfamPF008081.0E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MRKRLDTRFP AARIKKIMQA DEDVGKIAMA VPLLVSKALE LFLQDLCDRT YEITLKKGAK  60
TMNSFHLKHC IQSFNVFDFL KDVVSRVPDL GGSDAGAESA TKRRKVAEED DHDSDDDTKR  120
NHANETANNS GTGRGRGRGR GRGRGRGSRA VEKGDYHAHS EKLEDAAADV SHQKDDENQK  180
QNDERMVDYV AESAVDSKNI SAAKCSPEVV APARNFDLNI DLNESVESTP MPSEVPLSST  240
ATPTPTPTAT PAPAPAPAPA PDELKHEEIP GWSLSEMEKM AIDPIQLANL NQGLDEEEED  300
YDEEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A9e-22272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135145RGRGRGRGRGR
2137146RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.78710.0fruit| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g072150.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2446000.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-39b1 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251241.10.0dr1-associated corepressor
TrEMBLM1CM701e-162M1CM70_SOLTU; Uncharacterized protein
STRINGSolyc11g072150.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA75552029
Representative plantOGRP21791635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G19490.12e-56NF-YC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]