PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g071810.1.1
Common Namefasciated, LOC100191118
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 178aa    MW: 19906.6 Da    PI: 9.6948
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g071810.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY232.88.4e-72101714170
               YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                           sse+vCy+qCnfCntilavsvP + ++++vtvrCGhC+++lsvn+    q+l+ ++   ++l+ ++  + +++++n+k + ++++s+s+
  Solyc11g071810.1.1  10 SPSSERVCYLQCNFCNTILAVSVPCSNMLTLVTVRCGHCANMLSVNIGSLIQALPLQDV--QKLQRQQYTNVENNSSNYKAYGSSSSSSSK 98 
                         5689****************************************************996..556666677777777777777666666665 PP

               YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          ++ ++    + +  p++ p irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Solyc11g071810.1.1  99 FNRYSS--IVSPQIEPKI-PSIRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 171
                         555533..3334444554.46*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.4E-7312171IPR006780YABBY protein
SuperFamilySSF470951.96E-8116164IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.0E-5119165IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0009030anatomycarpel
PO:0025263anatomylocule
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSFDMTFSSS PSSERVCYLQ CNFCNTILAV SVPCSNMLTL VTVRCGHCAN MLSVNIGSLI  60
QALPLQDVQK LQRQQYTNVE NNSSNYKAYG SSSSSSSKFN RYSSIVSPQI EPKIPSIRPP  120
EKRQRVPSAY NRFIKEEIQR IKASNPDISH REAFSTAAKN WAHFPHIHFG LKLEGNK*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}.
UniprotTISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Studies indicate that the fruit shape genes SUN (EU491503) OVATE, and FASCIATED (AK248039) belong to IQD/SUN, OFP and the YABBY gene family, respectively.
    [PMID: 23371549]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g071810.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5576740.0Solanum lycopersicum FAS protein (fasciated) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234390.11e-130YABBY transcription factor
SwissprotQ9XFB07e-67YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLB2YHV81e-128B2YHV8_SOLLC; FAS protein
STRINGSolyc11g071810.1.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Representative plantOGRP22101236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-64YABBY family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Cong B,Barrero LS,Tanksley SD
    Regulatory change in YABBY-like transcription factor led to evolution of extreme fruit size during tomato domestication.
    Nat. Genet., 2008. 40(6): p. 800-4
    [PMID:18469814]
  3. Huang Z,Van Houten J,Gonzalez G,Xiao H,van der Knaap E
    Genome-wide identification, phylogeny and expression analysis of SUN, OFP and YABBY gene family in tomato.
    Mol. Genet. Genomics, 2013. 288(3-4): p. 111-29
    [PMID:23371549]
  4. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]