PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g068620.1.1
Common NameLOC101263872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 261aa    MW: 30390.7 Da    PI: 8.8188
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g068620.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM145.52.9e-4561362128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                          pGfrF Pt+eel+++yL+kk+egkk el++vi+ v iy+++Pw+Lpk     +  +++++w+fF++r++++a+g r+ r+t+ gyWkatg
  Solyc11g068620.1.1   6 SPGFRFYPTEEELISFYLHKKLEGKKPELDRVIPVVTIYDFDPWHLPKfhgelC-MGDREQWFFFVPRQEREARGGRPCRTTNCGYWKATG 95 
                         69***************************999***************6566532.34667******************************* PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +   v+s++++++g+kk++vfykg+ap+g+kt+W m+eyr+
  Solyc11g068620.1.1  96 SPSYVYSSNNKVIGVKKSMVFYKGKAPTGKKTKWKMNEYRA 136
                         ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100548.0625162IPR003441NAC domain
SuperFamilySSF1019412.88E-495160IPR003441NAC domain
PfamPF023651.8E-237135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVEIISPGFR FYPTEEELIS FYLHKKLEGK KPELDRVIPV VTIYDFDPWH LPKFHGELCM  60
GDREQWFFFV PRQEREARGG RPCRTTNCGY WKATGSPSYV YSSNNKVIGV KKSMVFYKGK  120
APTGKKTKWK MNEYRAIQEE VNSTLAIPKL RHEMSLCRIY VISGSFRAFD RRPIAPTITR  180
EPSKSIINQG GISMENVTKM EAISDENLFM EEQDYVNLNH NDQIPIINQE ININSHNNKR  240
VKSNLHDETL ISGWEQFNWM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-34516017163NO APICAL MERISTEM PROTEIN
1ut4_B4e-34516017163NO APICAL MERISTEM PROTEIN
1ut7_A4e-34516017163NO APICAL MERISTEM PROTEIN
1ut7_B4e-34516017163NO APICAL MERISTEM PROTEIN
3swm_A5e-34516020166NAC domain-containing protein 19
3swm_B5e-34516020166NAC domain-containing protein 19
3swm_C5e-34516020166NAC domain-containing protein 19
3swm_D5e-34516020166NAC domain-containing protein 19
3swp_A5e-34516020166NAC domain-containing protein 19
3swp_B5e-34516020166NAC domain-containing protein 19
3swp_C5e-34516020166NAC domain-containing protein 19
3swp_D5e-34516020166NAC domain-containing protein 19
4dul_A4e-34516017163NAC domain-containing protein 19
4dul_B4e-34516017163NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.151670.0callus| leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g068620.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2170040.0Solanum lycopersicum chromosome 11 clone C11HBa0303G16, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251070.10.0NAC domain-containing protein 90
SwissprotQ9FMR31e-81NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A3Q7IZW10.0A0A3Q7IZW1_SOLLC; Uncharacterized protein
STRINGSolyc11g068620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Representative plantOGRP22781136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.18e-84NAC domain containing protein 90
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]