PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g066220.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 338aa    MW: 39209.2 Da    PI: 6.7843
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g066220.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like28.82.6e-09238277344
             G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtle 44 
                          ++Wt eL ++  eav++L  ++kA Pk++le m v++Lt e
  Solyc11g066220.1.1 238 NMKWTAELEKKLEEAVREL--EDKAGPKNVLERMCVQDLTKE 277
                         599****************..*******************87 PP

2Response_reg36.82e-1320112193
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+vd +p+ +++++ +le++ + +v++ ++++ al +l+++   +Dli++D +m +md le++k+ +  + +  ii+++++ + e+++ea
  Solyc11g066220.1.1  20 ILLVDPDPTSLSNITAILEEHSF-KVTAIEQATVALSILRKHIdqFDLIMVDANMLEMDYLEFIKSTQLIK-DKSIILMSSEVTIEMIKEA 108
                         89*********************.***************999778*******************9977777.8889999999999999998 PP

                         HHTT CS
        Response_reg  90 lkaG 93 
                            G
  Solyc11g066220.1.1 109 PTQG 112
                         6665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.4E-1717154No hitNo description
SuperFamilySSF521722.42E-1517134IPR011006CheY-like superfamily
SMARTSM004480.005518125IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011020.81619134IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.6E-920113IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.19E-921108No hitNo description
Gene3DG3DSA:1.10.10.602.2E-7234278IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MDCEIICNVD VPSAYIGLRI LLVDPDPTSL SNITAILEEH SFKVTAIEQA TVALSILRKH  60
IDQFDLIMVD ANMLEMDYLE FIKSTQLIKD KSIILMSSEV TIEMIKEAPT QGICFIYEKS  120
LISSLKLKDI WKHVRWHDKK ENEESQHYNA KQVNLMDNIS CPTKMQDLKG KSKENCSATY  180
LDQEIDSLME KDAAKRSKRM RSTNEETQVK HSVSSEKEEE HSFLSKISTK RPEKKRRNMK  240
WTAELEKKLE EAVRELEDKA GPKNVLERMC VQDLTKECLT YRLKVSINTD PKNDKFRMYN  300
QLLQRSLTRN ILPKCSIQAT PLQMLMNYFE EHTDLNH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g066220.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2200590.0Solanum lycopersicum chromosome 11 clone C11HBa0249E07, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164912.11e-168PREDICTED: two-component response regulator ORR22-like
TrEMBLK4B5C91e-175K4B5C9_SOLLC; Uncharacterized protein
STRINGSolyc11g066220.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4899714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-18response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]