PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g066170.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARR-B
Protein Properties Length: 364aa    MW: 41476.4 Da    PI: 6.9351
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g066170.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.17.2e-12237288255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +++Wt+eL ++  eav++LG  +kA Pk++l+ m  ++Lt+  v   L kYR+
  Solyc11g066170.1.1 237 RKMKWTTELDKKLDEAVRELG--DKAGPKNVLKRMREPDLTVGCVTYRLKKYRS 288
                         68******************4..89****************************7 PP

2Response_reg32.83.7e-1220112193
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+vd + + +++++++le++ + +v++ ++++ al +l+e+   +Dli++D +m +m+ le++k  +  + + pi++++ + ++++++ea
  Solyc11g066170.1.1  20 VLLVDPDTTCLSNITTMLEQHSF-KVTAIEQASTALFILRENIdqFDLIMVDANMLEMNYLEFIKYTQLIK-DKPIVLMSPEVTMKMLKEA 108
                         89*********************.***************888778*******************9987777.899***********99999 PP

                         HHTT CS
        Response_reg  90 lkaG 93 
                          + G
  Solyc11g066170.1.1 109 PSQG 112
                         7777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.3E-1617142No hitNo description
SuperFamilySSF521723.27E-1417120IPR011006CheY-like superfamily
PROSITE profilePS5011017.88319134IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.1E-820114IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.17E-721108No hitNo description
Gene3DG3DSA:1.10.10.602.3E-11234292IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-8237289IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005622Cellular Componentintracellular
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MDCEIIRNVD IPSAYVGLKV LLVDPDTTCL SNITTMLEQH SFKVTAIEQA STALFILREN  60
IDQFDLIMVD ANMLEMNYLE FIKYTQLIKD KPIVLMSPEV TMKMLKEAPS QGICFIYKKS  120
LISSLKLRNV WKHVKWHNKK ADEKSLHYNA NPIHVSDNAS CPTKMQDLKG KSIVNSSETH  180
QDQDVGSLIE KDEAKRSKRI RSTDEEAQAK RSGPSEKEKD HSLLSRKSTE RPEKKRRKMK  240
WTTELDKKLD EAVRELGDKA GPKNVLKRMR EPDLTVGCVT YRLKKYRSQK KQAPNDEAIT  300
SMNFNEEQHS NVVNSSNLSM DVNELIQGAD IPQPPEVPLA SSSDCSLNEC ADWINEFLQL  360
EDF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232238EKKRRKM
2233237KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g066170.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164912.10.0PREDICTED: two-component response regulator ORR22-like
TrEMBLM1D9L20.0M1D9L2_SOLTU; Uncharacterized protein
STRINGSolyc11g066170.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4899714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-22response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]