PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g066050.1.1
Common NameLOC101256250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 320aa    MW: 34628.3 Da    PI: 9.0701
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g066050.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.6e-3969128362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+ lkcprCds+ntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  Solyc11g066050.1.1  69 EAGLKCPRCDSSNTKFCYFNNYSLSQPRHFCKNCRRYWTRGGALRNVPVGGGCRRNKRNK 128
                         6779*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3252119IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3271126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.85172126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAFSSFPIYL DHPNLHHLQQ QPDHHQQGNP GLDNPQLLPP PTQVGGGPGS IRPGSMVNRA  60
RIAKLPLPEA GLKCPRCDSS NTKFCYFNNY SLSQPRHFCK NCRRYWTRGG ALRNVPVGGG  120
CRRNKRNKSS SNNNSAKSGG GGGLMGNSNN ASTSGIPSIN CSMEMIGHHF SQSSTQFTSL  180
MGAFQNLNNY GGGLIQPPTH QLVGEMGFQI GSNNLLPSLV ASNNFEHPTN LYPNFQNEGT  240
TTTTTTTIEA SNGVTQQVKM EDNNRQGMNS STKQFLGTLE NNNQYWDVAN ANANANVNSW  300
IGFSSDLNNN SLSTTNHLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.245710.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g066050.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250963.10.0dof zinc finger protein DOF5.1
TrEMBLK4D9L40.0K4D9L4_SOLLC; Uncharacterized protein
STRINGSolyc11g066050.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-41OBF-binding protein 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]