PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g065540.1.1
Common NameLOC101259609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 310aa    MW: 35990.4 Da    PI: 5.0016
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g065540.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.24.1e-46121372128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG+rF P+deel+ +yLkkkv ++ l+  ++ik+v++yk+ P++L +++   +ekewyfF++r++ky++g+r+nra+ +gyWkatg dk+
  Solyc11g065540.1.1  12 PPGYRFCPHDEELILHYLKKKVMNEFLPY-NIIKDVNLYKYCPNELAENFPIlGEKEWYFFTPRRRKYPNGERPNRAAGTGYWKATGADKP 101
                         9***************************9.89**************8543333899*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ k+ +vg +k Lvfy+g+ p+g kt+W+mhe+r+
  Solyc11g065540.1.1 102 IIH-KNVKVGFRKALVFYEGKPPNGIKTNWIMHEFRV 137
                         ***.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-559163IPR003441NAC domain
PROSITE profilePS5100553.78711163IPR003441NAC domain
PfamPF023655.4E-2512137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MVETRDHNFV YPPGYRFCPH DEELILHYLK KKVMNEFLPY NIIKDVNLYK YCPNELAENF  60
PILGEKEWYF FTPRRRKYPN GERPNRAAGT GYWKATGADK PIIHKNVKVG FRKALVFYEG  120
KPPNGIKTNW IMHEFRVDES RMIKTHASDM RLDDWVLCRI YKKVDKSSKT QTPPQKDDDH  180
EQENPINLAE VENPINLAEV ENPINSGAEV ENPINSGAEV WNPTNSGAIA NYFYEETMNS  240
CGESQPTYQN NPNIAINPYS CYDPTLNYVL NLPPPFPLDN MQYEPNTNLS DQINYNIYDC  300
DDLDKNQFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-561216916174Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17276PRRRK
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Increased expression during grain maturation and senescence. Not induced during flower development. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in flag leaves. Expressed in green spikes, peduncles and stamens. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) and the hexaploid wheat (T.aestivum) carry a one bp insertion generating a non-functional allele of this gene. They have a delayed senescence and a lower grain protein, zinc and iron content (PubMed:17124321). {ECO:0000269|PubMed:17124321}.
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g065540.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251362.10.0NAC domain-containing protein 2-like
SwissprotA0SPJ42e-62NAMB1_TRIDC; NAC transcription factor NAM-B1
SwissprotA0SPJ61e-62NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLK4D9G40.0K4D9G4_SOLLC; Uncharacterized protein
STRINGSolyc11g065540.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-62NAC domain containing protein 47
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]