PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g051000.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 193aa    MW: 22518.6 Da    PI: 10.0614
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g051000.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR147.56.1e-152622990
                FAR1 29 tkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                        t+r+ +C+keg+   +k++    +++r+etrt+C a++ ++++++gk+ v+++e++HnH+l+
  Solyc11g051000.1.1  2 TSRKITCYKEGYGGLDKRD-MLVKKPRKETRTSCLAHMIISRQSNGKFSVISFEEKHNHPLV 62
                        78999***********999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.7E-12262IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MTSRKITCYK EGYGGLDKRD MLVKKPRKET RTSCLAHMII SRQSNGKFSV ISFEEKHNHP  60
LVHQSLGKAS LGFTKRDHKN YLRDKRKESL QYGVARSLVN YFEERYEANF LNAWEEILEK  120
CDLKDNSWLK NTFAIREKWS MSYGRNIFSA SMQSTQLSES FNGSLKGYLK SDLDIVQFFK  180
NFQRADDDKR AN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g051000.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2470751e-147Solanum lycopersicum strain Heinz 1706 chromosome 11 clone slm-22d4 map 11, complete sequence
GenBankAC2471401e-147Solanum lycopersicum strain Heinz 1706 chromosome 11 clone slm-57f15 map 11, complete sequence
GenBankAC2471411e-147Solanum lycopersicum strain Heinz 1706 chromosome 11 clone slm-10l5 map 11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016481065.12e-46PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_018632604.12e-46PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_018632605.12e-46PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLK4D8R21e-141K4D8R2_SOLLC; Uncharacterized protein
STRINGSolyc11g051000.1.11e-142(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-11FAR1-related sequence 5
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]