PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g050730.1.1
Common NameLOC101256155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 202aa    MW: 22579.4 Da    PI: 10.0191
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g050730.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.41.6e-1356101247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT++E+  ++++   +G+g+W++Ia+ +   Rt  q+ s+ qky
  Solyc11g050730.1.1  56 NPWTEDEQTAFLKGLDFHGKGNWSKIAKDFVPSRTSTQVASHAQKY 101
                         69*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.47350106IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-1251102IPR009057Homeodomain-like
SuperFamilySSF466892.47E-1453105IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-1453104IPR006447Myb domain, plants
SMARTSM007174.7E-1154104IPR001005SANT/Myb domain
PfamPF002492.1E-1156101IPR001005SANT/Myb domain
CDDcd001676.07E-1157102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MERNCTVCGG NGHNQRTCSE KGKSIKLFGV EITTTTSAGG AMSKKDSMER RVKKGNPWTE  60
DEQTAFLKGL DFHGKGNWSK IAKDFVPSRT STQVASHAQK YFMRLLGANE RKYHKKSSVF  120
DLRLDQLEDT HDHAIVPLGN NYKSQNVPSV VPNYYMMKRV LPLTWVYMYP YYHRDYASTS  180
ASATTFNKPL SGISSSSNSS S*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g050730.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2470790.0Solanum lycopersicum strain Heinz 1706 chromosome 11 clone hba-30m22 map 11, complete sequence
GenBankAC2471360.0Solanum lycopersicum strain Heinz 1706 chromosome 11 clone sle-51n5 map 11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250846.11e-152transcription factor MYBS3-like
TrEMBLA0A3Q7IWL81e-150A0A3Q7IWL8_SOLLC; Uncharacterized protein
STRINGSolyc11g050730.1.11e-151(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-27MYB_related family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]