PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g045350.1.1
Common NameLOC101260397
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Nin-like
Protein Properties Length: 987aa    MW: 108349 Da    PI: 5.1778
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g045350.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85e-29595646152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Solyc11g045350.1.1 595 AEKHVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 646
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.166578666IPR003035RWP-RK domain
PfamPF020424.1E-26599646IPR003035RWP-RK domain
SuperFamilySSF542773.27E-22883970No hitNo description
Gene3DG3DSA:3.10.20.2403.1E-24886968No hitNo description
PROSITE profilePS5174520.035886968IPR000270PB1 domain
PfamPF005642.3E-17886967IPR000270PB1 domain
SMARTSM006662.5E-23886968IPR000270PB1 domain
CDDcd064074.18E-30887967No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 987 aa     Download sequence    Send to blast
MERGVDFWAS PKGQMEGVAS FDASTRSSNV DSFNNVMEIM NLDAYAGWCT SPSAAEHMLA  60
SYAAFSPINH MSQSYAPFEG LSYTEQNSGA FPPMDANMVV SNHDGGEKMM FGQTDDQLHF  120
MVDSVDGEDG LGAKRSRRSS QPSDGADIGN SMIPRSPSQP LAERMLRALA MFKESSAAGI  180
LAQVWIPMKN GDQYVLSTCE QPYLLDQVLS GYREVSRKFT FDTEIKPGAI PGLPGRVFSS  240
RIPEWTSNVL YYKEAEYLRV QYAVNHEVRG SIALPVFEDD ACETPCCAVL ELVTMKEKRN  300
FDLEMDHVCQ ALQAVNLRST APPRLHSQNL SNNQKDALAE ITDVLRAVCH AHKLPLALTW  360
IPCNVTEGEG DEPIRVRARG CNTSLNEKCV LCVEDTACYV SDKEMQGFVH ACMEHFLEEG  420
EGIVGKALQS NHPFFYPDVK EYHISEYPLV HHARKFGLNA AVAIRLRSTF TGNDDYILEF  480
FLPTSMKGST EQQLLLNNLS GTMQRICKSL RTVADVELVG QDTKFGLQDG SVPNLPPIAL  540
SRKNFQHSLD SNSNSVNEAP LGACDSKSAG THADDSHEQT MTGSRRQIEK KRSTAEKHVS  600
LSVLQQYFSG SLKDAAKSIG VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVLESV  660
QGVEGGLKFD PASGGLVPAG SITQDFDAQR SIFFPFKDVS VKNPTSVFQD TVSVPSSSGN  720
DKENSMVKME EDFFADGNQL SQSNHVNTSS FKEVTKSSIE VSGYCYESKL PLTDSGNASL  780
GPFLSKGGCR RWGLNNDTLD NVDCQFTSQC SYSMAVGSDV DSKMKEDNEM DGDGGVIEHN  840
QASSSAMTDS SNGSESMING SSSSTHSRGA EKHSKIEVNC GDNGSTITVK ATYKEDTIRF  900
KFDLSAGCFQ LYEDIAKRFK LHTETFQLKY LDEEEEWVML VNDADLHECL EILDFSGGRT  960
VKFLVRDTPC ALGSSGSSNC FLASGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.91000.0callus| flower| fruit| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g045350.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0093971e-06Solanum lycopersicum genomic DNA, chromosome 8, complete sequence, clone: C08SLm0010D08
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250776.10.0protein NLP9
RefseqXP_010313114.10.0protein NLP9
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A3Q7IXG90.0A0A3Q7IXG9_SOLLC; Uncharacterized protein
STRINGSolyc11g045350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]