PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g044750.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Whirly
Protein Properties Length: 237aa    MW: 26449.1 Da    PI: 10.6532
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g044750.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly202.36.1e-63601981139
              Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvr 91 
                         sv+k+kaal+ ++++ptf+ ldsg +kl+r+G ++l++ ++++erkydWek+q falsatev++l+++++++s+effhdp++ +sn+G+vr
  Solyc11g044750.1.1  60 SVFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQLFALSATEVGSLISMGTRDSSEFFHDPSMLSSNAGQVR 150
                         79***************************************************************************************** PP

              Whirly  92 kalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                         k+l+++P +dGsG+fv+lsv n+ +k+n++f+vPv+ aefav+r++++
  Solyc11g044750.1.1 151 KSLSIKPNADGSGYFVSLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFS 198
                         *********************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.3E-7547217IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.33E-6453231IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.5E-5961195IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MMFFSRHIRN QLLHKKLSGE DVKGSIWQNA INTFAAFSTV RQDVVADAGK REGRVFAPYS  60
VFKGKAALSA EPRLPTFNRL DSGGVKLNRR GVIMLTFWPS VGERKYDWEK RQLFALSATE  120
VGSLISMGTR DSSEFFHDPS MLSSNAGQVR KSLSIKPNAD GSGYFVSLSV VNNNLKTNDR  180
FTVPVTTAEF AVMRTAFSFA LPHIMGWDRF TNRPSESISQ SPSKVVPQLM EAEWDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A1e-123452161172StWhy2
3n1i_A1e-123452161172protein StWhy2
3n1j_A1e-123452161172Protein StWhy2
3n1k_A1e-123452161172protein StWhy2
3n1l_A1e-123452161172protein StWhy2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.115250.0callus| flower| fruit| trichome
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g044750.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2425118e-08Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-17i17 map 1, complete sequence
GenBankAC2428258e-08Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-12f19 map 1, complete sequence
GenBankAC2458088e-08Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-12c9 map 1, complete sequence
GenBankAC2466528e-08Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-43g4 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010313085.11e-171mtDNA-binding protein WHIRLY2-like isoform X1
SwissprotD9J0341e-165WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A3Q7JMC91e-167A0A3Q7JMC9_SOLLC; Uncharacterized protein
STRINGSolyc11g044750.1.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97822228
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.14e-96WHIRLY 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]