![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Solyc11g039750.1.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 61aa MW: 7047.95 Da PI: 7.5074 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 31 | 5.9e-10 | 24 | 59 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 rg W Ede+l ++v+++G+++ +Ia++++ gR++ Solyc11g039750.1.1 24 RGHWRSHEDERLRELVEKYGPHNCYAIAQKLQ-GRSD 59 899*****************************.**97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 8.58E-7 | 16 | 59 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.246 | 19 | 60 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-9 | 22 | 59 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.2E-7 | 24 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.18E-5 | 27 | 59 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 61 aa Download sequence Send to blast |
MESSLLFSSL FFSPHNCVYS MCSRGHWRSH EDERLRELVE KYGPHNCYAI AQKLQGRSDL 60 * |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21399993}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Solyc11g039750.1.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019244658.1 | 9e-16 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | Q6R0C4 | 1e-14 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | A0A3Q7IV36 | 2e-37 | A0A3Q7IV36_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g039750.1.1 | 3e-38 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA30019 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 2e-16 | myb domain protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Solyc11g039750.1.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|