PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g019990.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 344aa    MW: 39301.3 Da    PI: 5.4039
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g019990.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like52.41.2e-16133179451
             G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                          +Wt++LH +F++av+qL  + +  Pk il++m+ +gLt+ +v+SHLQ
  Solyc11g019990.1.1 133 TKWTNNLHVKFMKAVKQL-EKGRCYPKDILHVMNFPGLTRMQVASHLQ 179
                         68****************.999************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23004.6E-615102No hitNo description
SuperFamilySSF521721.46E-61695IPR011006CheY-like superfamily
SuperFamilySSF466891.15E-12128180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-16129179IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-14133180IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MADMTSTTML MLSKEKQKVD VMILNIHSSN MPTFELLAQA VALDIISLIV YDDYNELEAK  60
KTLDMGAYLY LKKPFDENLV KYLWQFVWRK RILKEKAKEG SIADNDMGGE NEEQFEKKKD  120
VSKTEVVRRK DYTKWTNNLH VKFMKAVKQL EKGRCYPKDI LHVMNFPGLT RMQVASHLQV  180
QPHYLGIGNP FYNPFSSAQK NIGGELKQQH NPIFGMLGSQ EQENPIMKNT HYGPNSVLNS  240
EDHHSEKEHN FVLNMAKGAT NMNANFQQYQ GSNSCVMENC DVYFSLNNVD YVFQSLGPLG  300
ANLPNEQDSE FDQVYSDDQN LGPPDANLPN EQGSEFDQVY SHD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g019990.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2467438e-12Solanum lycopersicum strain Heinz 1706 chromosome 2 clone hba-11o22 map 2, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019066444.10.0two-component response regulator ORR21-like
TrEMBLM1CN233e-89M1CN23_SOLTU; Uncharacterized protein
STRINGSolyc11g019990.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-19response regulator 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]