PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g018660.1.1
Common NameLOC101245609
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 312aa    MW: 36056.1 Da    PI: 6.3467
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g018660.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.8e-5371351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++      ++ee+ewyfFs++d+ky+tg+r+nrat +g+Wkatg+
  Solyc11g018660.1.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRMEPWDIQDrckLGYEEESEWYFFSHKDRKYPTGTRTNRATGAGFWKATGR 96 
                         69****************************.9***************952422233667******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+vls k++ +g++ktLvfy+grap+g+k+dW+mheyrl
  Solyc11g018660.1.1  97 DKAVLS-KEKIIGMRKTLVFYRGRAPNGRKSDWIMHEYRL 135
                         ******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-605156IPR003441NAC domain
PROSITE profilePS5100558.457156IPR003441NAC domain
PfamPF023652.3E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEIESCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRMEPW DIQDRCKLGY  60
EEESEWYFFS HKDRKYPTGT RTNRATGAGF WKATGRDKAV LSKEKIIGMR KTLVFYRGRA  120
PNGRKSDWIM HEYRLQTSQH GPPQEEGWVV CRAFKKPSPS NNNYYMRGTN TSYSTRPPPS  180
LSQMPSYYIT NINPLNQTSN FNHQFPLNHQ ISSQNNIGYD NNQLLIHELP QLDSPTTIST  240
SLATNDHQGQ NSINNNNNED QFCDEWSVDD KLFAPQVMEA PSSSSYSYPN FLLDGNDQNH  300
MSQLLHCYPD L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-50716217171NO APICAL MERISTEM PROTEIN
1ut4_B9e-50716217171NO APICAL MERISTEM PROTEIN
1ut7_A9e-50716217171NO APICAL MERISTEM PROTEIN
1ut7_B9e-50716217171NO APICAL MERISTEM PROTEIN
3swm_A1e-49716220174NAC domain-containing protein 19
3swm_B1e-49716220174NAC domain-containing protein 19
3swm_C1e-49716220174NAC domain-containing protein 19
3swm_D1e-49716220174NAC domain-containing protein 19
3swp_A1e-49716220174NAC domain-containing protein 19
3swp_B1e-49716220174NAC domain-containing protein 19
3swp_C1e-49716220174NAC domain-containing protein 19
3swp_D1e-49716220174NAC domain-containing protein 19
4dul_A9e-50716217171NAC domain-containing protein 19
4dul_B9e-50716217171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Predominantly expressed in immature xylem vessels, only in some cells just beside xylem vessels. Also present in various vascular cells of older part of the roots, near the location of emergence of the lateral roots. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131}.
UniprotTISSUE SPECIFICITY: Expressed in developing protoxylems in roots and shoots (PubMed:16103214, PubMed:16581911, PubMed:17565617, PubMed:18952777). Detected in root protoxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Present in developing vessels of the secondary xylem in roots undergoing secondary growth (PubMed:18952777). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:21284754, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269|PubMed:23023171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g018660.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:21498679, ECO:0000269|PubMed:22345435, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2179161e-13Solanum lycopersicum LeftsH6 mRNA for FtsH protease, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250398.10.0NAC domain-containing protein 30
RefseqXP_019066418.10.0NAC domain-containing protein 30
SwissprotQ9C8W91e-105NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A3Q7ITC80.0A0A3Q7ITC8_SOLLC; Uncharacterized protein
STRINGSolyc11g018660.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.12e-97vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Kakehi J, et al.
    Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana.
    PLoS ONE, 2015. 10(1): p. e0117309
    [PMID:25625317]
  4. Li Z, et al.
    A Transcriptional and Metabolic Framework for Secondary Wall Formation in Arabidopsis.
    Plant Physiol., 2016. 172(2): p. 1334-1351
    [PMID:27566165]
  5. de Lucas M, et al.
    Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation.
    Plant Cell, 2016. 28(10): p. 2616-2631
    [PMID:27650334]
  6. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]
  7. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]