PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g017470.1.1
Common NameLOC101267475
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 292aa    MW: 33463.9 Da    PI: 7.1619
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g017470.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.31e-5171302128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         p+GfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++PwdLp  +  +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk++
  Solyc11g017470.1.1   7 PAGFRFHPTDEELVMHYLCRKCDAQPIAV-PIIAEIDLYKYNPWDLPDLALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPI 96 
                         89*************************99.88***************65556799************************************ PP

                 NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +   + +g+kk Lvfy g+apkgekt+W+mheyrl
  Solyc11g017470.1.1  97 GR--PKSMGIKKALVFYAGKAPKGEKTNWIMHEYRL 130
                         98..6789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-613157IPR003441NAC domain
PROSITE profilePS5100558.9556157IPR003441NAC domain
PfamPF023652.7E-277130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVELQFPAGF RFHPTDEELV MHYLCRKCDA QPIAVPIIAE IDLYKYNPWD LPDLALYGEK  60
EWYFFSPRDR KYPNGSRPNR AAGSGYWKAT GADKPIGRPK SMGIKKALVF YAGKAPKGEK  120
TNWIMHEYRL AHVDRSARNK NNSLRLDDWV LCRIYNKKGT IEKNQLNIRK MNGEMSPAVS  180
EGDVKPEIVP ISVSTNPSST SYHVYNDFTY FNSPDSLTKL HADSSCSEHV PSPEFTYEKE  240
VQSEPKPKPS EWEKTALDFP FNYTDATASE LQSCYEMSPL QDIFMYLQKP F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-80216311174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.30950.0flower| fruit| leaf| root
Function -- GeneRIF ? help Back to Top
  1. These results suggested that ethylene-dependent and -independent processes are regulated by SlNAC4 in the fruit ripening regulatory network.[SlNAC4]
    [PMID: 24265273]
  2. Data show the important role of NAC-type transcription factor SlNAC4 functions as a stress-responsive transcription factor in positive modulation of abiotic stress tolerance.
    [PMID: 25063324]
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g017470.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4539990.0Solanum lycopersicum cultivar Ailsa Craig NAC4 domain protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001265908.10.0NAC domain-containing protein 2-like
SwissprotQ390131e-130NAC2_ARATH; NAC domain-containing protein 2
TrEMBLK4D6Q00.0K4D6Q0_SOLLC; NAC4 domain protein
STRINGSolyc11g017470.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-133NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Florentin A,Damri M,Grafi G
    Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
    Dev. Dyn., 2013. 242(10): p. 1121-33
    [PMID:23798027]
  3. Jensen MK, et al.
    ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
    FEBS Open Bio, 2013. 3: p. 321-7
    [PMID:23951554]
  4. Wang YX
    Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
    Mol. Biol. Rep., 2013. 40(11): p. 6451-8
    [PMID:24057250]
  5. Zhu M, et al.
    A new tomato NAC (NAM/ATAF1/2/CUC2) transcription factor, SlNAC4, functions as a positive regulator of fruit ripening and carotenoid accumulation.
    Plant Cell Physiol., 2014. 55(1): p. 119-35
    [PMID:24265273]
  6. Zhu M, et al.
    The abiotic stress-responsive NAC-type transcription factor SlNAC4 regulates salt and drought tolerance and stress-related genes in tomato (Solanum lycopersicum).
    Plant Cell Rep., 2014. 33(11): p. 1851-63
    [PMID:25063324]
  7. Yang X, et al.
    Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
    Plant Cell Rep., 2015. 34(6): p. 943-58
    [PMID:25666276]
  8. Du Q,Wang H
    The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
    Plant Signal Behav, 2015. 10(10): p. e1078955
    [PMID:26340415]
  9. Takasaki H, et al.
    SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
    Plant J., 2015. 84(6): p. 1114-23
    [PMID:26518251]
  10. Liu Y,Sun J,Wu Y
    Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
    J. Plant Res., 2016. 129(5): p. 955-962
    [PMID:27216423]
  11. Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
    Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
    PLoS ONE, 2016. 11(9): p. e0162327
    [PMID:27618630]
  12. Zhao J,Missihoun TD,Bartels D
    The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
    Planta, 2018. 248(4): p. 1017-1027
    [PMID:30027414]