PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g017360.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 182aa    MW: 20034.9 Da    PI: 4.55
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g017360.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.23.3e-071753339
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                        +WT++E+  ++++ +   +g+W++I+r    +Rt+kq
  Solyc11g017360.1.1 17 SWTEQEHRSFLQGLAINEKGDWRSISRDCVITRTAKQ 53
                        7**************************8876788886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-61453IPR009057Homeodomain-like
PfamPF002495.5E-61653IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-51753IPR009057Homeodomain-like
CDDcd001672.09E-51753No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MQNHDSKADV EWRKKASWTE QEHRSFLQGL AINEKGDWRS ISRDCVITRT AKQEDADATG  60
TSQVPHTKDM IGSAYGGSQA VPNTSSESML PRDRTNAEQM IEVVGEESTD HIAVVNVGSD  120
VNVDAESSLL PSKQSCTAEG VTELRDVEEE ERKGKEEYIE RCVHITPTSK IESAASRIEN  180
N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g017360.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3022311e-112S.lycopersicum DNA sequence from clone LE_HBa-291F9, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361808.12e-36PREDICTED: transcription factor DIVARICATA-like
RefseqXP_015170955.12e-36PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A3Q7ISW91e-96A0A3Q7ISW9_SOLLC; Uncharacterized protein
STRINGSolyc11g017360.1.11e-131(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44541329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-13MYB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]