PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g017210.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family FAR1
Protein Properties Length: 85aa    MW: 9821.24 Da    PI: 8.9713
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g017210.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR141.35e-133377145
                FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeek 45
                        kfY +YA++ GFsvrk++ ++s++++ i+ ++fvCskeg+r ++ 
  Solyc11g017210.1.1 33 KFYLDYAHRNGFSVRKNRISRSRKDKFIIGQEFVCSKEGFRLKKC 77
                        6***************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.6E-113377IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MNAVVSFVPQ LGEQELREPY IGMEFQSLDT GFKFYLDYAH RNGFSVRKNR ISRSRKDKFI  60
IGQEFVCSKE GFRLKKCNQA CNCD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g017210.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1717331e-142Solanum lycopersicum chromosome 11 clone C11HBa0034I10, complete sequence
GenBankCU4578051e-142S.lycopersicum DNA sequence from clone SL_MboI-121I3, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019068484.13e-46protein FAR1-RELATED SEQUENCE 5
RefseqXP_025884696.18e-48protein FAR1-RELATED SEQUENCE 11-like
RefseqXP_025884722.14e-47protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_025884850.14e-46protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_025888960.15e-45protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A3Q7IST48e-56A0A3Q7IST4_SOLLC; Uncharacterized protein
STRINGSolyc11g017210.1.12e-56(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA645860
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.22e-15FAR1 family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]