PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g017100.1.1
Common NameLOC101262278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 477aa    MW: 54677.7 Da    PI: 6.5117
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g017100.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2707.9e-83914721373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++ Ll  A+ +++++++la + L +l ++++  gd++qR+aayf+ +L arl+   s  y+ +   +t+    +ee+ a++ f++vsP++
  Solyc11g017100.1.1  91 LIHSLLISATSIDENSMNLAIENLHELYQNVTLFGDSIQRMAAYFADGLIARLLTRKSPFYDMIMKPPTQ----EEEFLAFTQFYKVSPFY 177
                         57899999***********************************************999999988766665....688889999******** PP

                GRAS  92 kfshltaNqaIleavege.....ervHiiDf.disqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.g 173
                         +f+h+t NqaIle +e+e       +H+iDf dis+G+QWp+L+q+L++ +   +  sl+iTg g+      +el+et+ rL +fA+ + +
  Solyc11g017100.1.1 178 QFAHFTSNQAILEVFEKEleynnGLLHVIDFfDISYGFQWPSLIQSLSENSttLNRISLKITGYGR----TIDELRETETRLVSFAKGFrN 264
                         *****************998887889****55****************999545566*********....99***************9758 PP

                GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.adhnsesFlerflealey 263
                         ++fef+ +    l+  +l++L  +++E+la+nl+++l +l      + s+++++Lk v +l P +v++veqe ++  +++F+ rf+++l+y
  Solyc11g017100.1.1 265 LSFEFQGV----LSGYKLSNLTKRKNETLAINLIFHLNSLS-----TYSKISKTLKEVHDLCPSIVTIVEQEgCKIPKTNFMPRFMDSLHY 346
                         *******8....89999******************999997.....3344568*******************7777*************** PP

                GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve 352
                         ++a+fdsl+  lp +s er ++E+  lg+ei+nv+   +++   + ++e++e+ + r+e+ GF  vpls k+ +qakll++  +    +++
  Solyc11g017100.1.1 347 FAAMFDSLDDCLPIDSIERLSIEKNHLGKEIKNVLNYDNSSsrYNDDNEQMETCKGRMESHGFIGVPLSCKNIMQAKLLMKIRSYSNSTIQ 437
                         ***********************************9887763135789*******************************987774446666 PP

                GRAS 353 ..............eesgslvlgWkdrpLvsvSaW 373
                                       e+  ++ l W+dr++v++SaW
  Solyc11g017100.1.1 438 idgginggfrvfeiEDPRAISLAWQDRSIVTASAW 472
                         446666665555655566777************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.26665439IPR005202Transcription factor GRAS
PfamPF035142.7E-8091472IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MGDIVDHEEE LLSLRLAIVN DSSCCDNHIN KKIIKKRKRR ELMMNFINTW DLNESNCEGK  60
ILSLLELREM MLKNDVKKKG HIINDGKGLH LIHSLLISAT SIDENSMNLA IENLHELYQN  120
VTLFGDSIQR MAAYFADGLI ARLLTRKSPF YDMIMKPPTQ EEEFLAFTQF YKVSPFYQFA  180
HFTSNQAILE VFEKELEYNN GLLHVIDFFD ISYGFQWPSL IQSLSENSTT LNRISLKITG  240
YGRTIDELRE TETRLVSFAK GFRNLSFEFQ GVLSGYKLSN LTKRKNETLA INLIFHLNSL  300
STYSKISKTL KEVHDLCPSI VTIVEQEGCK IPKTNFMPRF MDSLHYFAAM FDSLDDCLPI  360
DSIERLSIEK NHLGKEIKNV LNYDNSSSRY NDDNEQMETC KGRMESHGFI GVPLSCKNIM  420
QAKLLMKIRS YSNSTIQIDG GINGGFRVFE IEDPRAISLA WQDRSIVTAS AWHCVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-33964738375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13439KKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1717340.0Solanum lycopersicum chromosome 11 clone C11HBa0064J13, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250586.10.0PREDICTED: scarecrow-like protein 23
TrEMBLK4D6L30.0K4D6L3_SOLLC; Uncharacterized protein
STRINGSolyc11g017100.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
AsteridsOGEA123541823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.15e-49SCARECROW-like 21
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]