PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g013620.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 254aa    MW: 28748.2 Da    PI: 8.3602
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g013620.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.7e-1398143247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +rWT++E+  ++++   +G+g+W+ Ia+ +   Rt+ q+ s+ qky
  Solyc11g013620.1.1  98 NRWTEDEQRAFLKGLDFHGKGNWTNIAKDFVPSRTPTQVASHAQKY 143
                         69*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.92691148IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-1192144IPR009057Homeodomain-like
SuperFamilySSF466896.13E-1594147IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-1495146IPR006447Myb domain, plants
SMARTSM007174.0E-1196146IPR001005SANT/Myb domain
PfamPF002496.1E-1198143IPR001005SANT/Myb domain
CDDcd001678.41E-1199144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MLYLLIDGCF KGLSKNYRFL ILFAFFLVML NCSTVIMLTM QVEAVAIYCI CCIVCVFGCI  60
SWSIDSRCAG KIWSFSLDRS CRCSAVCVCL NQMIKKGNRW TEDEQRAFLK GLDFHGKGNW  120
TNIAKDFVPS RTPTQVASHA QKYFVRLLDA NSNSNERKKK RKKSSVFDLR IEKTEDTDQA  180
MVPLGNNQET HNVPNYMMKS VPTVMPLTWV YIYPYNDHYA STSISTTTFD KPISGISCSS  240
SSSSEDDNLE LKL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156162RKKKRKK
2158162KKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.234779e-81cell culture| fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g013620.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2471350.0Solanum lycopersicum strain Heinz 1706 chromosome 11 clone slm-6o7 map 11, complete sequence
GenBankAC2540570.0Solanum lycopersicum strain Heinz 1706 chromosome 11 clone sle-28f9 map 11, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057414.11e-101probable transcription factor At5g61620
TrEMBLM1CNS85e-87M1CNS8_SOLTU; Uncharacterized protein
STRINGSolyc11g013620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-20MYB family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]