PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g012720.1.1
Common NameLOC101251840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 405aa    MW: 45816.7 Da    PI: 5.2114
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g012720.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.52e-24292375186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k ev+aL+ +r+++++++ +g +k+  Weev++ +++ g+ r++k+Ckekwen+nk+yk++ ++ k r +++ ++cpyf++l+
  Solyc11g012720.1.1 292 RWPKLEVQALVSVRTRLDHKFLKG-AKGSVWEEVADGLAKMGYIRTAKKCKEKWENINKYYKRTIDSGKTR-PKNYRSCPYFHELD 375
                         8**********************9.99******************************************98.888899******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.166285348IPR017877Myb-like domain
PfamPF138375.8E-20291377No hitNo description
CDDcd122032.77E-20291354No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MEPLIDGDGH PPNDITSFAD NLAPFPESTN VVYENPSAVI APPGIHRLPV SPVRKLRPVR  60
FGNGRNYVDM VDSNCDIDEA LMTCTSDLGF LSQFSAQNAS TVLPMECGFV NSLDENGVAK  120
CSEVGISAVQ QMKSELDADC FNLISQSRIL ETEFSSSSDS ESSEPIEEHL NRKRKRGTRK  180
SLKLSLEDMV KKLMDKQEQM HKQLIEMLEK KEEERIIREE AWKQQEVERA KRDVELRAEE  240
TSRNLALIAF LENLLGEDFQ IPKSSEVTSL VKDEGEVHGQ EADIRSDPCN RRWPKLEVQA  300
LVSVRTRLDH KFLKGAKGSV WEEVADGLAK MGYIRTAKKC KEKWENINKY YKRTIDSGKT  360
RPKNYRSCPY FHELDSLYKN GLLNQGAGNC VKIETENKNV DPEE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250561.10.0PREDICTED: trihelix transcription factor GT-2
TrEMBLK4D6760.0K4D676_SOLLC; Uncharacterized protein
STRINGSolyc11g012720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128841620
Representative plantOGRP1130157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.12e-44Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]