PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g008000.1.1
Common NameLOC101261771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 529aa    MW: 59472.9 Da    PI: 4.5091
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g008000.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.23.9e-54101381128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv +yL++k+ g++++  + i+e+diykvePwdLp  +++k+++ ewyfFs  dkky +g r+nrat++gyWk+tgkd
  Solyc11g008000.1.1  10 LAPGFRFHPTDEELVRYYLRRKIYGRTFKS-DLISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDKKYGNGARTNRATEKGYWKTTGKD 99 
                         579*************************99.99***************6347788888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v+++k+++vg+kktLv+++grapkg++t+Wvmheyrl
  Solyc11g008000.1.1 100 RAVHRNKSQVVGMKKTLVYHSGRAPKGQRTNWVMHEYRL 138
                         *************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-629161IPR003441NAC domain
PROSITE profilePS5100559.06310161IPR003441NAC domain
PfamPF023657.5E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009819Biological Processdrought recovery
GO:0010150Biological Processleaf senescence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MESRGSSKLL APGFRFHPTD EELVRYYLRR KIYGRTFKSD LISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSVLDKKYGN GARTNRATEK GYWKTTGKDR AVHRNKSQVV GMKKTLVYHS  120
GRAPKGQRTN WVMHEYRLID EALDKAGIPQ DAFVLCRVFQ KSGAGPKNGE QYGAPFIEEE  180
WEDDELQVPS KDETTEDFVF GDDIYFDANE LDQILGTDKA VAGASFPSDY SYGENGSTEE  240
TNNSSDAQQP DELKPIDLAV QKNFNAEQVN HEYIGESSKN MNSEDGDYLL NEPIVNGTDD  300
LQFNDEAFLE ANDLSNPVQA DSSGFDMLEE YLTYFDANDD FQNMSFDPSV FFGNDDQISD  360
QALLPQKDVG EVTQQPIAPN EGFSEDKNGI ASSSKLVPTK FESDYQYPFI KQASQMLGNI  420
HAPPAFASEF PTKDAILRLN SFSRSASSVQ VTAGNGTRWP LGKHVYYNII LSLGLSRGSS  480
DDSSMDSFHK IHPGKTTSTI SRGWFCYLFF SFLMLLMSLR IGTIICAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-471016717171NO APICAL MERISTEM PROTEIN
1ut4_B6e-471016717171NO APICAL MERISTEM PROTEIN
1ut7_A6e-471016717171NO APICAL MERISTEM PROTEIN
1ut7_B6e-471016717171NO APICAL MERISTEM PROTEIN
3swm_A6e-471016720174NAC domain-containing protein 19
3swm_B6e-471016720174NAC domain-containing protein 19
3swm_C6e-471016720174NAC domain-containing protein 19
3swm_D6e-471016720174NAC domain-containing protein 19
3swp_A6e-471016720174NAC domain-containing protein 19
3swp_B6e-471016720174NAC domain-containing protein 19
3swp_C6e-471016720174NAC domain-containing protein 19
3swp_D6e-471016720174NAC domain-containing protein 19
4dul_A6e-471016717171NAC domain-containing protein 19
4dul_B6e-471016717171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.53450.0callus| fruit| leaf| trichome
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the anthers and the upper parts of the stamen filaments after stage 7 to 9 of flower budding. In stage 10 flower buds, expressed in the anthers and pollen grains. Weakly expressed in mature flowers at stage 12. {ECO:0000269|PubMed:24323506}.
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex and stems. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (Ref.6, PubMed:24323506, PubMed:25219309). Promotes reactive oxygen species (ROS) production during drought-induced leaf senescence. In response to abscisic acid (ABA)-mediated drought stress signals, binds directly to the promoters of RBOHC and RBOHE genes, encoding ROS biosynthetic enzymes, resulting in ROS accumulation and triggering leaf senescence via programmed cell death (PCD). ROS-induced leaf senescence sustains plant survival under drought conditions (PubMed:22313226). Involved in heat stress response. Modulates PCD through a ROS-mediated positive feedback control under heat stress conditions. This may provide an adaptation strategy for plant survival under extreme heat stress conditions (PubMed:25219309). Acts as repressor in preventing anther dehiscence during stamen development by suppressing genes that participate in jasmonic acid (JA) biosynthesis, such as DAD1, AOS, AOC3, OPR3 and 4CLL5/OPCL1 (PubMed:24323506). {ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:24323506, ECO:0000269|PubMed:25219309, ECO:0000269|Ref.6}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00343DAPTransfer from AT3G10500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc11g008000.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) (PubMed:22313226, PubMed:25219309). Induced by heat shock (PubMed:25219309). Induced by cold, drought stress and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:22313226, ECO:0000269|PubMed:25219309}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0137470.0Lycopersicon esculentum clone 132610F, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250028.10.0NAC domain-containing protein 53
SwissprotQ949N01e-136NAC53_ARATH; NAC domain-containing protein 53
TrEMBLA0A3Q7JIC20.0A0A3Q7JIC2_SOLLC; Uncharacterized protein
STRINGSolyc11g008000.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Representative plantOGRP1057159
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-131NAC domain containing protein 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
    Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress.
    Plant Cell, 2014. 26(12): p. 4656-79
    [PMID:25549671]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]