PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc11g005380.1.1
Common NameLOC101262765
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Trihelix
Protein Properties Length: 496aa    MW: 56244.2 Da    PI: 7.7973
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc11g005380.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix94.21.3e-2954137186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+++e+laL+++r+em+ ++r+++lk plW+e+s+km+e g++r++k+C+ek+en+ k++k++k+g+++r  ++ +++++f+qle
  Solyc11g005380.1.1  54 RWPHEETLALLKIRSEMDVAFRDSNLKSPLWDEISRKMAELGYNRNAKKCREKFENIYKYHKRTKDGRSGR--QTGKNYRFFEQLE 137
                         8********************************************************************97..56668******97 PP

2trihelix96.13.2e-30365450186
            trihelix   1 rWtkqevlaLiearremeerlrr.gklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         rW+k ev aLi++r++++ ++++ g++k+plWe++s  m++ g+ r++k+Ckekwen+nk+y+++ke++kkr +e+s+tcpyf+ql+
  Solyc11g005380.1.1 365 RWPKAEVEALIKLRTNVDLQYQDnGSSKGPLWEDISCGMKKLGYDRNAKRCKEKWENINKYYRRVKESQKKR-PEDSKTCPYFHQLD 450
                         8*********************7589*********************************************8.99**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-451113IPR001005SANT/Myb domain
CDDcd122031.57E-2453118No hitNo description
PROSITE profilePS500907.44553111IPR017877Myb-like domain
PfamPF138372.3E-2053137No hitNo description
SMARTSM007171.9362425IPR001005SANT/Myb domain
CDDcd122036.40E-22364430No hitNo description
PROSITE profilePS500906.679364423IPR017877Myb-like domain
PfamPF138373.5E-23364452No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MLESSVLLEN TAAGGAVTGA DGEASELKNE GGGGGGSVGG GSEEEDKNFS GGNRWPHEET  60
LALLKIRSEM DVAFRDSNLK SPLWDEISRK MAELGYNRNA KKCREKFENI YKYHKRTKDG  120
RSGRQTGKNY RFFEQLELLD SQSLFSSPPL NHSQINRMET MPVPMPMPMT MIKPAASGCQ  180
DFGMDHSRVR GFNPGFMSTS TSTTSSSGKE SDGSVKKKRK LASYFERLMK EVLDKQEDLQ  240
NKFLEAMEKC EKDRIARDEA WKMQEIARLK KEQEALAHER AISAAKDAAV IAFLQKVSDQ  300
TIQLQLPTDL PHRHTEERES ESMKTIGNQE NVVMQQDNDK ENIDKQEIDS AGENSNSFQT  360
NSSSRWPKAE VEALIKLRTN VDLQYQDNGS SKGPLWEDIS CGMKKLGYDR NAKRCKEKWE  420
NINKYYRRVK ESQKKRPEDS KTCPYFHQLD SIYQNKSKKQ LPIMETPGSN MKAGEILMQI  480
INQQQQQQAL ERTEC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215220KKKRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.68790.0callus| flower| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249868.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-125TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLK4D4F10.0K4D4F1_SOLLC; Uncharacterized protein
STRINGSolyc11g005380.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
AsteridsOGEA97942328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-71Trihelix family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]