PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g086130.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 632aa    MW: 70644.8 Da    PI: 7.3225
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g086130.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-23120220198
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f k+lt+sd+++ g +++pk++a+++        +++   +tl+ +d +g+sW++++iyr++++r++lt+GW+ Fv++++L +gD++vF  
  Solyc10g086130.1.1 120 FAKTLTQSDANNGGGFSVPKNCADTIfptldynVNPPV--QTLSATDIHGKSWQFRHIYRGTPERHLLTTGWSTFVNQKKLVAGDSIVFL- 207
                         89**********************99****98533333..49************************************************. PP

                         -SSSEE..EEEEE- CS
                  B3  85 dgrsefelvvkvfr 98 
                          ++++ +  ++++r
  Solyc10g086130.1.1 208 -RNENDKISIGIRR 220
                         .4577777888887 PP

2Auxin_resp99.16.3e-33280362183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a + a+++++Fev+++P+++t+eF vk+++v++al+++++ GmRfkm feted     ++Gt+++v++ dp++Wp+S+Wr+L+
  Solyc10g086130.1.1 280 ATKLATNGQPFEVIFYPQSTTPEFFVKASRVKAALQIPWCSGMRFKMPFETEDLVISWFMGTISSVQANDPSQWPDSPWRMLQ 362
                         567899************************************************99999**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.0E-36111224IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-28114222IPR015300DNA-binding pseudobarrel domain
CDDcd100174.08E-19119220No hitNo description
PfamPF023627.2E-21120220IPR003340B3 DNA binding domain
SMARTSM010191.1E-18120222IPR003340B3 DNA binding domain
PROSITE profilePS5086312.929120222IPR003340B3 DNA binding domain
PfamPF065072.5E-28280362IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MFLQNLLMAD NKSNCFDSRL WQACAGTMVK MPAVDSIVLY FPQGHAEHAG VNVEFRSDVK  60
IPSYIPCRVS SIKYMAERET DEVFAKIRLT PVRLSEFFET PEEEGMVKIG SDNSRKPLSF  120
AKTLTQSDAN NGGGFSVPKN CADTIFPTLD YNVNPPVQTL SATDIHGKSW QFRHIYRGTP  180
ERHLLTTGWS TFVNQKKLVA GDSIVFLRNE NDKISIGIRR IKKKSVAMEP ETSPWWFPSV  240
GNLTIPRGGF SAFLRDDHNT NSSWSLINRG NVKAESVIEA TKLATNGQPF EVIFYPQSTT  300
PEFFVKASRV KAALQIPWCS GMRFKMPFET EDLVISWFMG TISSVQANDP SQWPDSPWRM  360
LQVTWDEPNL LHNVMCVNPW LVEPVSNMPT INFNPYTPPL KKLRLSHTSD FPLNGHLPMS  420
GFPNNHLEFS IDPPMSSFPI HHLLRPYGCP PNNTPVGMQG ARHAPYNLSL PDIHTNNLLS  480
SLSPVGFPSL HHVVASPNTS NNTMIPKPSR NAGISSLLTL GSSTQTNKKF DSEKTTQFVL  540
FGQPIVIEQQ TSQSNSRISV SPRHATNSFS DGNEYKKENT SDSSDTSFVH NSVPDYLPSK  600
SFRSEENVEI GHSKVFIESE DIGQTKQLGE W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A6e-761638351388Auxin response factor 5
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g086130.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5651310.0Solanum lycopersicum auxin response factor 14 (ARF14) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055116.10.0auxin response factor 18-like
SwissprotQ653H70.0ARFR_ORYSJ; Auxin response factor 18
TrEMBLA0A3Q7INH10.0A0A3Q7INH1_SOLLC; Auxin response factor
STRINGSolyc10g086130.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59224115
Representative plantOGRP5261578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.11e-167auxin response factor 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Huang J,Li Z,Zhao D
    Deregulation of the OsmiR160 Target Gene OsARF18 Causes Growth and Developmental Defects with an Alteration of Auxin Signaling in Rice.
    Sci Rep, 2016. 6: p. 29938
    [PMID:27444058]