PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g085620.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 401aa    MW: 45046.4 Da    PI: 7.1633
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g085620.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.51.5e-332882155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Solyc10g085620.1.1 28 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 82
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.382585IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-312683IPR009057Homeodomain-like
SuperFamilySSF466898.6E-172783IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-242883IPR006447Myb domain, plants
PfamPF002492.3E-103081IPR001005SANT/Myb domain
PfamPF143791.0E-24128175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSVPERHLFL QGGNGNGDSG LVLSTDAKPR LKWTPDLHER FIEAVNQLGG ADKATPKSVL  60
KLMGIQGLTL YHLKSHLQKY RLSKNLHGQA NASGANKAVA AAGVERISEN SATCMSNPSM  120
VPQPNKNIQI SEAIQMQIEV QRRLHEQLEV QRHLQLRIEA QGKYLQSVLE KAQETLGRQN  180
METVGLEAVK VQLSEFVSKA SNQCLNSPFT DIKELSGFHS QQTQATQPTD RSIDSCLTSR  240
DGSLRDNTMH DNQIGLRPFG FTPSIECKDI ENDTRLQQTE LRWCDNLKEN RRLFSPMNEG  300
REKTFTRETN CNNLSMSIGL QDEKLNGSMN HSDGNFNGTE RDVKLFHQVT NRSESVPQRH  360
KSSQEYKLSY FEPKLDLNMH DETDAASSCK QFDLNGFSWS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-222884157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-222884157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-222884157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-222884157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-222784158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.246050.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g085620.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2449200.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-6e17 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010312321.10.0myb-related protein 2 isoform X1
RefseqXP_010312322.10.0myb-related protein 2 isoform X1
SwissprotQ9FK471e-127PHLA_ARATH; Myb-related protein 1
TrEMBLA0A3Q7IMN90.0A0A3Q7IMN9_SOLLC; Uncharacterized protein
STRINGSolyc10g085620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-126G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]