PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g083510.1.1
Common NameLOC101261864
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 390aa    MW: 42379.1 Da    PI: 9.4242
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g083510.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.91.1e-25156199144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgrsrsrk++e
  Solyc10g083510.1.1 156 DPEPGRCRRTDGKKWRCSRDVVAGQKYCERHVHRGRSRSRKPVE 199
                         79***************************************987 PP

2QLQ34.18.7e-1381115236
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                         +F+ aQ+q+L+   l++++++a++PvP+eLl  ++
  Solyc10g083510.1.1  81 YFSLAQWQELELHSLIFRHFVAGAPVPSELLHLVK 115
                         7*****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009510.009180116IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.11381116IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.5E-781114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.141156200IPR014977WRC domain
PfamPF088791.3E-21157199IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MDFNMKQWSN QHESENQESP TKLPRLLLDF HSVSSDSASA AALPLFVSEP TTSTTTCTKL  60
MSDSATTVTT KFPRIGSGGG YFSLAQWQEL ELHSLIFRHF VAGAPVPSEL LHLVKKSIIA  120
SPPPPPSYYF AHPYQQYPHY QQALMQSGYW GRAAMDPEPG RCRRTDGKKW RCSRDVVAGQ  180
KYCERHVHRG RSRSRKPVEI PTPANNGSKN NNTVSHHQAF GKMTGHAHAG GGAPQFSLSG  240
HSPSTNAPFH LNQRPIKGPP QEVLQKDVSI GDGKSSSGQI LRHFFDDWPR QQLQEGDNAA  300
TSLSISMPGV GGNPSSDFSL KLSTGNYYDS GTQVSNVERS TWGTSHHHVA SMGGPLAEAL  360
RSSTTNSSPT SVLHQLARGS ASEASYIST*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g083510.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0139770.0Lycopersicon esculentum clone 133022R, mRNA sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249453.10.0growth-regulating factor 3
TrEMBLA0A3Q7ILL40.0A0A3Q7ILL4_SOLLC; Uncharacterized protein
STRINGSolyc10g083510.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32832138
Representative plantOGRP9959611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-72growth-regulating factor 4
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]