PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g083450.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 290aa    MW: 34368.5 Da    PI: 5.9404
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g083450.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.14.5e-46261512128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         p+G+rF P+d+el+++yL k+++++ l+  + ikev++yk+ P dL     + +ekewyfF++r++ky++g+r+nra+ +gyWkatg dk+
  Solyc10g083450.1.1  26 PVGYRFCPRDDELITHYLLKRIRNEVLPH-DKIKEVNLYKYSPYDLAeIYPELGEKEWYFFTPRNRKYPNGHRPNRAAGRGYWKATGADKP 115
                         89************************999.88**************8345556999*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ ++ +vg +k Lvfy+g+ pkg kt+W+mheyr+
  Solyc10g083450.1.1 116 IIH-NNVTVGFRKALVFYEGKPPKGLKTNWIMHEYRV 151
                         ***.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-5420176IPR003441NAC domain
PROSITE profilePS5100553.21125177IPR003441NAC domain
PfamPF023651.3E-2426151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MESYEKNMAF INSNFENPNP NDFVFPVGYR FCPRDDELIT HYLLKRIRNE VLPHDKIKEV  60
NLYKYSPYDL AEIYPELGEK EWYFFTPRNR KYPNGHRPNR AAGRGYWKAT GADKPIIHNN  120
VTVGFRKALV FYEGKPPKGL KTNWIMHEYR VNESRRIKMH AADMKLDDWV LCMIYKRCTK  180
SKDSKKQKEQ EDELEDASKI NSAENYEWTM DSCLIEFAKR QFEDPYQYLN MSENVSIDCY  240
NNTFPIIDFN NLYQVPLDNL YQNPYYNTGT TESQNVLDDD SPDDKSTHQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-562517515166Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g083450.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249783.20.0NAC transcription factor 32-like
SwissprotQ8H4S46e-62NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLA0A3Q7ILV40.0A0A3Q7ILV4_SOLLC; Uncharacterized protein
STRINGSolyc10g083450.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-59NAC domain containing protein 32
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]