PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g083340.1.1
Common NameLOC101257914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 410aa    MW: 45930.4 Da    PI: 6.957
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g083340.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.53.1e-334498155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  Solyc10g083340.1.1 44 KPRLKWTPDLHERFIEAVTQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 98
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.51741101IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-3142100IPR009057Homeodomain-like
SuperFamilySSF466891.79E-1643101IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-244499IPR006447Myb domain, plants
PfamPF002491.0E-94697IPR001005SANT/Myb domain
PfamPF143796.7E-15143183IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MYHHHHQAPN MHPSTRMSFP ERHLFLQGGN ANGDSGLVLS TDAKPRLKWT PDLHERFIEA  60
VTQLGGADKA TPKSVLKLMG IQGLTLYHLK SHLQKYRLSK NHHGQANISG VNKAAASMEK  120
ICESTGSPKS NPSIGHQPNN NIPISEAIQM QIDVQRRLHE QLELRIEAQG KYLQAVLEKA  180
QETLGTQNLG TIGLEAAKVQ LSDLVSKVSN QCLNSAFSEI KELSGFHTPQ TQATQRLADC  240
SMDSCLTSSE GPLRDLQEMH NNQLGLRNLN FRPCTEEIEN QTRLQQTALR WRDDLKENRL  300
FPKIDEDTEK EFAKETNWSN LSMNVGIQGG KRNVNSSYVD ERLNGIDADI KLFHQTATDR  360
SDSTKPEKQV SPQEYKLPYF APKLDLNTDD QTDAASNCKQ LDLNGFSWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-2144100157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2143100158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269|PubMed:15923329}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g083340.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249439.10.0myb-related protein 2 isoform X2
SwissprotQ9SQQ91e-117PHL9_ARATH; Myb-related protein 2
TrEMBLA0A3Q7JG390.0A0A3Q7JG39_SOLLC; Uncharacterized protein
STRINGSolyc10g083340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.11e-122G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]