PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g081350.1.1
Common NameLOC101259896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 351aa    MW: 38396.1 Da    PI: 9.2236
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g081350.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.96.9e-16280322547
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk 
  Solyc10g081350.1.1 280 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLKR 322
                         79*************************************9993 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.6E-16271323No hitNo description
SMARTSM003381.8E-14276348IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634278323IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.19E-11280325No hitNo description
CDDcd147071.24E-24280325No hitNo description
PfamPF001706.0E-13280323IPR004827Basic-leucine zipper domain
PROSITE patternPS000360283298IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGSQGGGGGG GGGVGVNSIG VTQAQAQAQA HAQDPKTNAL ARQGSLYSLT LDEVQNQLGD  60
LGKPLSNMNL DELLKTVWTV EASQGMGGTD YGVLQHGQDA SGSSLNRQSS ITLTSDLSKK  120
TVDQVWQDIQ QGHKRDRIDR KAQERQPTLG EMTLEDFLVK AGVVAESTPG KKSLGSVLGV  180
DSMALPQQQA QWSQYQMQAM HPLPPQQHQQ QQQNMLPVFM PSHSAQQPLT IVSNPTIDAA  240
YPESQMTMSP TALLGTLSDT QTLGRKRVAP DDVVEKTVER RQKRMIKNRE SAARSRARKQ  300
AYTHELENKV SRLEEENERL KRQKEIEQVL PSVPLPEPKY QLRRTSSAPF *
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g081350.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249361.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-97AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A3Q7IL080.0A0A3Q7IL08_SOLLC; Uncharacterized protein
STRINGSolyc10g081350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-96ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  3. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]