PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g080960.1.1
Common NameLOC101249222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 267aa    MW: 29196 Da    PI: 8.9088
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g080960.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.78.5e-3188141155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av+qL G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Solyc10g080960.1.1  88 RPRLVWTPQLHKRFVDAVAQL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 141
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.52E-2085145IPR009057Homeodomain-like
PROSITE profilePS5129411.00485144IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-3187146IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-2489141IPR006447Myb domain, plants
PfamPF002494.1E-891140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPSPK ELMPLSQTLI TPNLAIAFDI QNPNTPNPKI TPLVHTLSSA  60
EFDSNSAELG GMAGSSGVGD EPARTLKRPR LVWTPQLHKR FVDAVAQLGI KNAVPKTIMQ  120
LMSVDGLTRE NVASHLQKYR LYLKRMQGLS HSGSVSGAGV DPATDHLFAS SPVPAHFLHP  180
GRGNSDHYMP FVPMSAVVGH APQFQQQYRH FGSPTNGQFE VPFLPRQSQQ PAQRMGTSVH  240
SSSPALESAT TANGRKVLTL FPNRDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A9e-3288144157Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.149131e-126leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g080960.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249324.10.0transcription factor MYBC1-like
SwissprotO222105e-63MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A3Q7ILT00.0A0A3Q7ILT0_SOLLC; Uncharacterized protein
STRINGSolyc10g080960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Representative plantOGRP11571753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-91G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]