PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g080540.1.1
Common NameLOC101264164
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 355aa    MW: 39809.1 Da    PI: 8.7439
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g080540.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.16.2e-18194248256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Solyc10g080540.1.1 194 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 248
                         788899***********************************************98 PP

2HD-ZIP_I/II127.74.9e-41194283191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +l
  Solyc10g080540.1.1 194 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTEENKRLHKELQELR-AL 283
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.232190250IPR001356Homeobox domain
SuperFamilySSF466892.01E-18191259IPR009057Homeodomain-like
SMARTSM003896.9E-16192254IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-17194248IPR009057Homeodomain-like
CDDcd000868.06E-15194251No hitNo description
PfamPF000461.8E-15194248IPR001356Homeobox domain
PROSITE patternPS000270225248IPR017970Homeobox, conserved site
SMARTSM003406.1E-25250293IPR003106Leucine zipper, homeobox-associated
PfamPF021834.6E-10250284IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MELALSLGGD NTPKPILFLE KSSSSSSSLH ENKVNKDVGF CMVLGKSCNE VERKKRSKKH  60
QEIRSSSIDP SLQLDLIPFS HGVSYNTCSK LSFPWLSQNL ATHEPAGLTN GPALDMTNRM  120
QLVVAEEAEE GAALSSPNSE ISNFQMNFPI YRNGKLINTK RDQCERDRDN NRWGNGNNYS  180
CSRISDEELD ASARKKLRLT KEQSAFLEES FKEHNTLNPK QKLALAKQLN LRPRQVEVWF  240
QNRRARTKLK QTEVDCEYLK KCCETLTEEN KRLHKELQEL RALKSSQPFY MQLPATTLTM  300
CPSCERVATT TSVTTTTTTT TPATTTTTTV AASNAVALHN HKLISVMTKL ECTN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242250RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g080540.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2442860.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-20a14 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249289.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-86HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A3Q7JFH00.0A0A3Q7JFH0_SOLLC; Uncharacterized protein
STRINGSolyc10g080540.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-68homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]