PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g078720.1.1
Common NameLOC101251632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 403aa    MW: 45312.1 Da    PI: 6.3149
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g078720.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.5e-32225279155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Solyc10g078720.1.1 225 KARIRWTQDLHDRFVECVNRLGGADKATPKAILKLMDSEGLTIFHVKSHLQKYRN 279
                         68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.434222282IPR017930Myb domain
SuperFamilySSF466891.79E-16223279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28223280IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-24225280IPR006447Myb domain, plants
PfamPF002493.0E-8229278IPR001005SANT/Myb domain
PfamPF143794.1E-20309356IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSIQNYELAS DCNLEFPQMG FCFQPESSVE NGCQQQQQPN FWPSTDSSSS RTIISRIGSS  60
PSAFFATERY LGLTQYDYQD NNNSCTQLSK NLDPQTTSYT QQCGNGFSAD SSARVDTDFP  120
KISMPSFIRS QFSSSQPFGP EGLYGNPFSN LSEKERILLL KSKLFREIDS SNRQPASIPF  180
QGNQDYGVSN NTCGFNLVHI RQQSGSQPAN SFNNSGCSGG SLSSKARIRW TQDLHDRFVE  240
CVNRLGGADK ATPKAILKLM DSEGLTIFHV KSHLQKYRNA KFIPESTEGR SGKTDCPNNV  300
TQIDSKTGMQ IKEALHMQLE VQRRLHEQLE IQRKLQLRIE EQGEQLKKIF EQQQQTTRSL  360
LETRNSSISS PADQFTPHED EVFAAESFNN THFQSNISYN DM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-23225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-23225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-23225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-23225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-23225282259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.228000.0callus| flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g078720.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2445800.0Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-40g6 map 10, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249167.10.0myb family transcription factor PHL5-like
TrEMBLA0A3Q7IKJ30.0A0A3Q7IKJ3_SOLLC; Uncharacterized protein
STRINGSolyc10g078720.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-71G2-like family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]