PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc10g078290.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 661aa    MW: 70976.1 Da    PI: 9.618
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc10g078290.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.5e-13176236262
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         ++ k+  r+++NRe+A  sRqRKk ++eeLe+kv  + +  ++L  +++    e  +lk++
  Solyc10g078290.1.1 176 EDEKKMARLIRNRESAHLSRQRKKHYVEELEDKVRIMHSTIQDLNAKISYVMAENVTLKTQ 236
                         5679999*************************************99999888888777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-14175239IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.749177237IPR004827Basic-leucine zipper domain
PfamPF001701.7E-11178236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-15179237No hitNo description
SuperFamilySSF579592.56E-12179237No hitNo description
CDDcd147045.34E-18180230No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MSDISGNQAA GGVMVMDTSS PEIVQRSSSS RLSNEVSPSL PQISTDVSGY LNVPSPESNG  60
SNHDVSRESS NDKKGLSDAK VLNCHSPESQ GSGNCGGLNY LSDSNKSVHS SPNLGSNSVK  120
GGTVEHKFKL EGVSANISNC SSSLLKRKKG GEDLNNASKH QKSSMFSLSD NVNNDEDEKK  180
MARLIRNRES AHLSRQRKKH YVEELEDKVR IMHSTIQDLN AKISYVMAEN VTLKTQLGGT  240
GVPPQVQPPP GMYPHPSMVY PWMSYPPPYM MKPQGSQVPL VPIPKLKPQA AAPAPKSTKK  300
GEKKKSEVKT KKVASISLLG VLFFMLLFGG LVPLLNVRYG GTREPFLGGF SVGSGFYEKH  360
HGRVLVVDGP VNGTGYSGKY SEKDYSSHCG RGDHSESNQQ NTYKAADEFV HMGNGSNPLA  420
ASLYVPRNDK LVKIDGNLII QSVLASEKAM ASHGGSDKNN RETGLAVPGD LAPAIPGSHP  480
RLYRSSAVGQ RALGTVEKEN VQSTMQQWYL EGVAGPLMSS GMCTEVFQFD VLSSAPGAIV  540
RATNGRNISM EQRQNATRIH RNRRILNGTP VSLSRPSHNI SEEQSGTAGK QENFTGNKSL  600
SSMVVSVLVD PREAGDADGD GIMGPKSLSR IFVVVLIDSV KYVTYSCMLP FKAAAPLVTT  660
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1552563RQNATRIHRNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.97340.0callus| fruit| leaf| stem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in salt and osmotic stress responses. Functions as a stress sensor and transducer in a signaling pathway that resembles an ER stress response. Following salt stress, BZIP17 is cleaved by SBT6.1 (S1P) and S2P at the C-terminus and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression of salt stress response genes (PubMed:17662035). Functions as a stress sensor and transducer in ER stress signaling pathway. ER stress induces proteolysis of BZIP17 by SBT6.1 (S1P) and S2P, and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones, as well as protein involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:17662035, ECO:0000269|PubMed:20876872}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc10g078290.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249119.10.0bZIP transcription factor 17
SwissprotO222081e-138BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A3Q7IK080.0A0A3Q7IK08_SOLLC; Uncharacterized protein
STRINGSolyc10g078290.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Representative plantOGRP21711628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-112bZIP family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]
  3. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]
  6. Cifuentes-Esquivel N, et al.
    bZIP17 regulates the expression of genes related to seed storage and germination, reducing seed susceptibility to osmotic stress.
    J. Cell. Biochem., 2018. 119(8): p. 6857-6868
    [PMID:29693271]
  7. Guan P, et al.
    SENSITIVE TO SALT1, An Endoplasmic Reticulum-Localized Chaperone, Positively Regulates Salt Resistance.
    Plant Physiol., 2018. 178(3): p. 1390-1405
    [PMID:30287478]